StarFunc result for job id O60242

User Input

>input (1522 residues)
MKAVRNLLIYIFSTYLLVMFGFNAAQDFWCSTLVKGVIYGSYSVSEMFPKNFTNCTWTLE
NPDPTKYSIYLKFSKKDLSCSNFSLLAYQFDHFSHEKIKDLLRKNHSIMQLCNSKNAFVF
LQYDKNFIQIRRVFPTNFPGLQKKGEEDQKSFFEFLVLNKVSPSQFGCHVLCTWLESCLK
SENGRTESCGIMYTKCTCPQHLGEWGIDDQSLILLNNVVLPLNEQTEGCLTQELQTTQVC
NLTREAKRPPKEEFGMMGDHTIKSQRPRSVHEKRVPQEQADAAKFMAQTGESGVEEWSQW
STCSVTCGQGSQVRTRTCVSPYGTHCSGPLRESRVCNNTALCPVHGVWEEWSPWSLCSFT
CGRGQRTRTRSCTPPQYGGRPCEGPETHHKPCNIALCPVDGQWQEWSSWSQCSVTCSNGT
QQRSRQCTAAAHGGSECRGPWAESRECYNPECTANGQWNQWGHWSGCSKSCDGGWERRIR
TCQGAVITGQQCEGTGEEVRRCNEQRCPAPYEICPEDYLMSMVWKRTPAGDLAFNQCPLN
ATGTTSRRCSLSLHGVAFWEQPSFARCISNEYRHLQHSIKEHLAKGQRMLAGDGMSQVTK
TLLDLTQRKNFYAGDLLMSVEILRNVTDTFKRASYIPASDGVQNFFQIVSNLLDEENKEK
WEDAQQIYPGSIELMQVIEDFIHIVGMGMMDFQNSYLMTGNVVASIQKLPAASVLTDINF
PMKGRKGMVDWARNSEDRVVIPKSIFTPVSSKELDESSVFVLGAVLYKNLDLILPTLRNY
TVINSKIIVVTIRPEPKTTDSFLEIELAHLANGTLNPYCVLWDDSKTNESLGTWSTQGCK
TVLTDASHTKCLCDRLSTFAILAQQPREIIMESSGTPSVTLIVGSGLSCLALITLAVVYA
ALWRYIRSERSIILINFCLSIISSNILILVGQTQTHNKSICTTTTAFLHFFFLASFCWVL
TEAWQSYMAVTGKIRTRLIRKRFLCLGWGLPALVVATSVGFTRTKGYGTDHYCWLSLEGG
LLYAFVGPAAAVVLVNMVIGILVFNKLVSRDGILDKKLKHRAGQMSEPHSGLTLKCAKCG
VVSTTALSATTASNAMASLWSSCVVLPLLALTWMSAVLAMTDKRSILFQILFAVFDSLQG
FVIVMVHCILRREVQDAFRCRLRNCQDPINADSSSSFPNGHAQIMTDFEKDVDIACRSVL
HKDIGPCRAATITGTLSRISLNDDEEEKGTNPEGLSYSTLPGNVISKVIIQQPTGLHMPM
SMNELSNPCLKKENSELRRTVYLCTDDNLRGADMDIVHPQERMMESDYIVMPRSSVNNQP
SMKEESKMNIGMETLPHERLLHYKVNPEFNMNPPVMDQFNMNLEQHLAPQEHMQNLPFEP
RTAVKNFMASELDDNAGLSRSETGSTISMSSLERRKSRYSDLDFEKVMHTRKRHMELFQE
LNQKFQTLDRFRDIPNTSSMENPAPNKNPWDTFKNPSEYPHYTTINVLDTEAKDALELRP
AEWEKCLNLPLDVQEGDFQTEV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O14514	0.371	0.357	0.000	1584	0.484	0.465	O14514.pdb.gz	AGRB1_HUMAN Adhesion G protein-coupled receptor B1 OS=Homo sapiens OX=9606 GN=ADGRB1 PE=1 SV=2
2	AFDB:O60242	0.999	0.999	0.000	1522	1.000	1.000	O60242.pdb.gz	AGRB3_HUMAN Adhesion G protein-coupled receptor B3 OS=Homo sapiens OX=9606 GN=ADGRB3 PE=1 SV=2
3	AFDB:O94910	0.237	0.243	2.602E-43	1474	0.159	0.164	O94910.pdb.gz	AGRL1_HUMAN Adhesion G protein-coupled receptor L1 OS=Homo sapiens OX=9606 GN=ADGRL1 PE=1 SV=1
4	AFDB:Q9HAR2	0.228	0.238	3.927E-43	1447	0.152	0.160	Q9HAR2.pdb.gz	AGRL3_HUMAN Adhesion G protein-coupled receptor L3 OS=Homo sapiens OX=9606 GN=ADGRL3 PE=1 SV=2
5	AFDB:O88917	0.229	0.230	5.092E-42	1515	0.164	0.165	O88917.pdb.gz	AGRL1_RAT Adhesion G protein-coupled receptor L1 OS=Rattus norvegicus OX=10116 GN=Adgrl1 PE=1 SV=1
6	AFDB:Q9QYP2	0.204	0.151	2.452E-39	2144	0.143	0.101	Q9QYP2.pdb.gz	CELR2_RAT Cadherin EGF LAG seven-pass G-type receptor 2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Celsr2 PE=1 SV=1
7	AFDB:E7FBY6	0.197	0.214	1.629E-33	1367	0.115	0.128	E7FBY6.pdb.gz	AGRA2_DANRE Adhesion G protein-coupled receptor A2 OS=Danio rerio OX=7955 GN=adgra2 PE=1 SV=2
8	AFDB:Q91ZV8	0.179	0.199	1.379E-31	1336	0.103	0.118	Q91ZV8.pdb.gz	AGRA2_MOUSE Adhesion G protein-coupled receptor A2 OS=Mus musculus OX=10090 GN=Adgra2 PE=1 SV=2
9	AFDB:Q4KP32	0.163	0.404	2.755E-19	590	0.096	0.247	Q4KP32.pdb.gz
10	AFDB:Q8C4G9	0.162	0.407	1.288E-14	578	0.070	0.183	Q8C4G9.pdb.gz	AGRA1_MOUSE Adhesion G protein-coupled receptor A1 OS=Mus musculus OX=10090 GN=Adgra1 PE=2 SV=1
11	PDB:1w0rA	0.086	0.207	1.404E-13	442	0.058	0.201	1w0rA.pdb.gz
12	PDB:4k5yC	0.143	0.759	1.639E-8	248	0.044	0.270	4k5yC.pdb.gz	Structure of class B GPCR corticotropin-releasing factor receptor 1.
13	PDB:7tynR	0.137	0.492	5.385E-8	373	0.041	0.166	7tynR.pdb.gz	A structural basis for amylin receptor phenotype.
14	PDB:7lciR	0.137	0.462	5.637E-8	393	0.043	0.165	7lciR.pdb.gz	Evolving cryo-EM structural approaches for GPCR drug discovery.
15	PDB:6vn7R	0.141	0.698	1.285E-7	263	0.036	0.209	6vn7R.pdb.gz	Cryo-EM structure of an activated VIP1 receptor-G protein complex revealed by a NanoBiT tethering strategy.
16	PDB:7d3sR	0.138	0.683	1.690E-7	266	0.033	0.188	7d3sR.pdb.gz	Structure of the human secretin receptor coupled to an engineered heterotrimeric G protein.
17	PDB:7vqxR	0.141	0.521	1.690E-7	361	0.047	0.197	7vqxR.pdb.gz	A distinctive ligand recognition mechanism by the human vasoactive intestinal polypeptide receptor 2.
18	PDB:6wpwR	0.136	0.462	3.358E-7	398	0.041	0.156	6wpwR.pdb.gz	Structural insights into differences in G protein activation by family A and family B GPCRs.
19	PDB:7durR	0.138	0.506	4.419E-7	371	0.036	0.148	7durR.pdb.gz	Molecular insights into ago-allosteric modulation of the human glucagon-like peptide-1 receptor.
20	PDB:7cz5R	0.139	0.670	1.911E-6	269	0.035	0.201	7cz5R.pdb.gz	Structural basis for activation of the growth hormone-releasing hormone receptor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2A3C1	0.0	1199	1466	0.456	0.473	A2A3C1_HUMAN Adhesion G protein-coupled receptor B2 OS=Homo sapiens OX=9606 GN=ADGRB2 PE=1 SV=1
2	A2A3C2	0.0	1452	1554	0.507	0.496	A2A3C2_HUMAN Adhesion G protein-coupled receptor B2 OS=Homo sapiens OX=9606 GN=ADGRB2 PE=1 SV=1
3	A2A3C3	0.0	1253	1499	0.420	0.426	A2A3C3_HUMAN Adhesion G protein-coupled receptor B2 OS=Homo sapiens OX=9606 GN=ADGRB2 PE=1 SV=1
4	A2A3C6	0.0	1206	1500	0.411	0.417	A2A3C6_HUMAN Adhesion G protein-coupled receptor B2 OS=Homo sapiens OX=9606 GN=ADGRB2 PE=1 SV=1
5	C0HL12	0.0	1399	1577	0.492	0.475	AGRB1_RAT Adhesion G protein-coupled receptor B1 OS=Rattus norvegicus OX=10116 GN=Adgrb1 PE=1 SV=1
6	O14514	0.0	1365	1584	0.493	0.473	AGRB1_HUMAN Adhesion G protein-coupled receptor B1 OS=Homo sapiens OX=9606 GN=ADGRB1 PE=1 SV=2
7	O60241	0.0	1442	1585	0.507	0.486	AGRB2_HUMAN Adhesion G protein-coupled receptor B2 OS=Homo sapiens OX=9606 GN=ADGRB2 PE=1 SV=2
8	O60242	0.0	3190	1522	1.000	1.000	AGRB3_HUMAN Adhesion G protein-coupled receptor B3 OS=Homo sapiens OX=9606 GN=ADGRB3 PE=1 SV=2
9	Q3UHD1	0.0	1372	1582	0.489	0.471	AGRB1_MOUSE Adhesion G protein-coupled receptor B1 OS=Mus musculus OX=10090 GN=Adgrb1 PE=1 SV=1
10	Q80ZF8	0.0	3152	1522	0.984	0.984	AGRB3_MOUSE Adhesion G protein-coupled receptor B3 OS=Mus musculus OX=10090 GN=Adgrb3 PE=1 SV=2
11	Q8CGM1	0.0	1436	1561	0.503	0.490	AGRB2_MOUSE Adhesion G protein-coupled receptor B2 OS=Mus musculus OX=10090 GN=Adgrb2 PE=1 SV=2
12	D3YXG0	2.16e-54	213	5634	0.065	0.018	HMCN1_MOUSE Hemicentin-1 OS=Mus musculus OX=10090 GN=Hmcn1 PE=1 SV=1
13	Q9HAR2	2.11e-53	208	1447	0.116	0.122	AGRL3_HUMAN Adhesion G protein-coupled receptor L3 OS=Homo sapiens OX=9606 GN=ADGRL3 PE=1 SV=2
14	Q9Z173	4.09e-52	204	1550	0.118	0.115	AGRL3_RAT Adhesion G protein-coupled receptor L3 OS=Rattus norvegicus OX=10116 GN=Adgrl3 PE=1 SV=1
15	Q96RW7	6.72e-52	204	5635	0.062	0.017	HMCN1_HUMAN Hemicentin-1 OS=Homo sapiens OX=9606 GN=HMCN1 PE=1 SV=2
16	Q80TS3	8.14e-52	203	1537	0.116	0.115	AGRL3_MOUSE Adhesion G protein-coupled receptor L3 OS=Mus musculus OX=10090 GN=Adgrl3 PE=1 SV=3
17	Q9NYQ6	1.12e-50	200	3014	0.113	0.057	CELR1_HUMAN Cadherin EGF LAG seven-pass G-type receptor 1 OS=Homo sapiens OX=9606 GN=CELSR1 PE=1 SV=1
18	A0A6I8PRU0	1.48e-50	200	3019	0.113	0.057	A0A6I8PRU0_HUMAN Cadherin EGF LAG seven-pass G-type receptor 1 OS=Homo sapiens OX=9606 GN=CELSR1 PE=1 SV=2
19	F1R9W4	2.78e-50	199	3044	0.126	0.063	F1R9W4_DANRE Cadherin EGF LAG seven-pass G-type receptor 1 isoform X2 OS=Danio rerio OX=7955 GN=celsr1a PE=1 SV=3
20	A0JBX1	3.66e-50	199	2941	0.116	0.060	A0JBX1_DANRE Cadherin EGF LAG seven-pass G-type receptor 2 OS=Danio rerio OX=7955 GN=off-road PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00002 7tm_2	3.9e-56	201.7	7 transmembrane receptor (Secretin family)
2	PF19188 AGRB_N	1.9e-59	212.3	Adhesion GPCR B N-terminal region
3	PF17376 DUF5398	4.2e+02	12.7	Family of unknown function (DUF5398)
4	PF16489 GAIN	2.7e-33	126.6	GPCR-Autoproteolysis INducing (GAIN) domain
5	PF01825 GPS	8.7e-11	53.6	GPCR proteolysis site, GPS, motif
6	PF02793 HRM	0.0021	29.6	Hormone receptor domain
7	PF19030 TSP1_ADAMTS	1.5e-06	39.7	Thrombospondin type 1 domain
8	PF19035 TSP1_CCN	0.03	26.0	CCN3 Nov like TSP1 domain
9	PF19028 TSP1_spondin	2.7e-25	99.8	Spondin-like TSP1 domain
10	PF00090 TSP_1	4.9e-38	140.4	Thrombospondin type 1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359630

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000298943	0.965	Complement C1q-like protein 3
2	9606.ENSP00000253407	0.955	C1q-related factor
3	9606.ENSP00000312185	0.770	Engulfment and cell motility protein 1
4	9606.ENSP00000403701	0.710	Beta-arrestin-2
5	9606.ENSP00000280333	0.701	Dedicator of cytokinesis protein 1
6	9606.ENSP00000272520	0.614	Complement C1q-like protein 2
7	9606.ENSP00000335285	0.598	Complement C1q-like protein 4
8	9606.ENSP00000475344	0.577	Apelin receptor
9	9606.ENSP00000366582	0.568	Protein FAM196B
10	9606.ENSP00000344173	0.550	Metabotropic glutamate receptor 8
11	9606.ENSP00000403636	0.531	Ras/Rap GTPase-activating protein SynGAP
12	9606.ENSP00000369981	0.518	Endophilin-A1
13	9606.ENSP00000262494	0.512	Guanine nucleotide-binding protein G(o) subunit alpha
14	9606.ENSP00000369604	0.512	F-box only protein 16
15	9606.ENSP00000423313	0.505	Polypeptide N-acetylgalactosaminyltransferase-like 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004930	1.000	G protein-coupled receptor activity
GO:0098772	0.717	molecular function regulator activity
GO:0030234	0.703	enzyme regulator activity
GO:0140677	0.590	molecular function activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0032501	0.968	multicellular organismal process
GO:0050896	0.964	response to stimulus
GO:0048856	0.929	anatomical structure development
GO:0016043	0.869	cellular component organization
GO:0051716	0.813	cellular response to stimulus
GO:0048518	0.779	positive regulation of biological process
GO:0007165	0.731	signal transduction
GO:0048522	0.655	positive regulation of cellular process
GO:0030154	0.640	cell differentiation
GO:0007275	0.590	multicellular organism development
GO:0140253	0.501	cell-cell fusion
GO:0043954	0.426	cellular component maintenance
GO:0044087	0.408	regulation of cellular component biogenesis
GO:0009653	0.396	anatomical structure morphogenesis
GO:0048731	0.384	system development
GO:0061061	0.364	muscle structure development
GO:1901888	0.347	regulation of cell junction assembly
GO:0065008	0.346	regulation of biological quality
GO:0050793	0.341	regulation of developmental process
GO:0006949	0.336	syncytium formation
GO:1901890	0.328	positive regulation of cell junction assembly
GO:0051965	0.324	positive regulation of synapse assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043226	0.796	organelle
GO:0030054	0.466	cell junction
GO:0043227	0.390	membrane-bounded organelle
GO:0043229	0.376	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]