StarFunc result for job id O60245

User Input

>input (1069 residues)
MLRMRTAGWARGWCLGCCLLLPLSLSLAAAKQLLRYRLAEEGPADVRIGNVASDLGIVTG
SGEVTFSLESGSEYLKIDNLTGELSTSERRIDREKLPQCQMIFDENECFLDFEVSVIGPS
QSWVDLFEGQVIVLDINDNTPTFPSPVLTLTVEENRPVGTLYLLPTATDRDFGRNGIERY
ELLQEPGGGGSGGESRRAGAADSAPYPGGGGNGASGGGSGGSKRRLDASEGGGGTNPGGR
SSVFELQVADTPDGEKQPQLIVKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVLITD
VNDNSPRFEKSVYEADLAENSAPGTPILQLRAADLDVGVNGQIEYVFGAATESVRRLLRL
DETSGWLSVLHRIDREEVNQLRFTVMARDRGQPPKTDKATVVLNIKDENDNVPSIEIRKI
GRIPLKDGVANVAEDVLVDTPIALVQVSDRDQGENGVVTCTVVGDVPFQLKPASDTEGDQ
NKKKYFLHTSTPLDYEATREFNVVIVAVDSGSPSLSSNNSLIVKVGDTNDNPPMFGQSVV
EVYFPENNIPGERVATVLATDADSGKNAEIAYSLDSSVMGIFAIDPDSGDILVNTVLDRE
QTDRYEFKVNAKDKGIPVLQGSTTVIVQVADKNDNDPKFMQDVFTFYVKENLQPNSPVGM
VTVMDADKGRNAEMSLYIEENNNIFSIENDTGTIYSTMSFDREHQTTYTFRVKAVDGGDP
PRSATATVSLFVMDENDNAPTVTLPKNISYTLLPPSSNVRTVVATVLATDSDDGINADLN
YSIVGGNPFKLFEIDPTSGVVSLVGKLTQKHYGLHRLVVQVNDSGQPSQSTTTLVHVFVN
ESVSNATAIDSQIARSLHIPLTQDIAGDPSYEISKQRLSIVIGVVAGIMTVILIILIVVM
ARYCRSKNKNGYEAGKKDHEDFFTPQQHDKSKKPKKDKKNKKSKQPLYSSIVTVEASKPN
GQRYDSVNEKLSDSPSMGRYRSVNGGPGSPDLARHYKSSSPLPTVQLHPQSPTAGKKHQA
VQDLPPANTFVGAGDNISIGSDHCSEYSCQTNNKYSKQMRLHPYITVFG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0A6YY83	0.718	0.620	0.000	1255	0.965	0.822	A0A0A6YY83.pdb.gz	A0A0A6YY83_MOUSE Protocadherin 7 OS=Mus musculus OX=10090 GN=Pcdh7 PE=1 SV=1
2	AFDB:Q8N6Y1	0.380	0.424	1.501E-80	951	0.283	0.318	Q8N6Y1.pdb.gz	PCD20_HUMAN Protocadherin-20 OS=Homo sapiens OX=9606 GN=PCDH20 PE=2 SV=2
3	AFDB:O95206	0.351	0.351	4.510E-72	1070	0.272	0.272	O95206.pdb.gz	PCDH8_HUMAN Protocadherin-8 OS=Homo sapiens OX=9606 GN=PCDH8 PE=1 SV=2
4	AFDB:F1QRP2	0.403	0.381	5.746E-72	1135	0.250	0.235	F1QRP2.pdb.gz	F1QRP2_DANRE Protocadherin 18a OS=Danio rerio OX=7955 GN=id:ibd5114 PE=4 SV=2
5	AFDB:A0A2R8QME5	0.374	0.366	1.784E-68	1094	0.245	0.239	A0A2R8QME5.pdb.gz	A0A2R8QME5_DANRE Protocadherin 19 OS=Danio rerio OX=7955 GN=fc83e05 PE=1 SV=1
6	AFDB:Q967D7	0.154	0.116	5.775E-20	1531	0.130	0.091	Q967D7.pdb.gz	TUTL_DROME Protein turtle OS=Drosophila melanogaster OX=7227 GN=tutl PE=1 SV=2
7	AFDB:Q9VS29	0.187	0.110	3.466E-19	2074	0.083	0.043	Q9VS29.pdb.gz	DSCL_DROME Cell adhesion molecule Dscam2 OS=Drosophila melanogaster OX=7227 GN=Dscam2 PE=2 SV=3
8	AFDB:Q4KMG0	0.128	0.110	1.056E-18	1287	0.123	0.103	Q4KMG0.pdb.gz	CDON_HUMAN Cell adhesion molecule-related/down-regulated by oncogenes OS=Homo sapiens OX=9606 GN=CDON PE=1 SV=2
9	PDB:4aq1A	0.106	0.146	1.278E-14	721	0.065	0.096	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
10	PDB:6velC	0.161	0.749	1.925E-13	209	0.057	0.292	6velC.pdb.gz	Regulation of multiple dimeric states of E-cadherin by adhesion activating antibodies revealed through Cryo-EM and X-ray crystallography.
11	AFDB:A8JFU2	0.131	0.083	1.208E-12	2118	0.078	0.039	A8JFU2.pdb.gz	CFA65_CHLRE Cilia- and flagella-associated protein 65 (Fragment) OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP65 PE=1 SV=1
12	PDB:5oj2B	0.132	0.185	3.879E-12	692	0.082	0.127	5oj2B.pdb.gz
13	AFDB:Q0KIB0	0.154	0.109	5.694E-12	1689	0.096	0.061	Q0KIB0.pdb.gz	Q0KIB0_DROME Sidestep III, isoform O OS=Drosophila melanogaster OX=7227 GN=side-III PE=1 SV=1
14	PDB:1e07A	0.125	0.169	1.828E-11	642	0.051	0.086	1e07A.pdb.gz
15	PDB:7q1yA	0.091	0.076	1.393E-8	1374	0.099	0.077	7q1yA.pdb.gz
16	PDB:7q5zA	0.081	0.069	1.065E-7	1344	0.092	0.073	7q5zA.pdb.gz
17	PDB:5a42A	0.072	0.053	3.092E-7	1597	0.095	0.064	5a42A.pdb.gz
18	PDB:6h03A	0.094	0.086	3.092E-7	1223	0.094	0.083	6h03A.pdb.gz
19	PDB:7vonA	0.095	0.077	4.340E-7	1399	0.072	0.055	7vonA.pdb.gz
20	PDB:4ziqA	0.071	0.056	5.529E-7	1450	0.101	0.074	4ziqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A087X2C4	2165	1269	0.990	0.834	A0A087X2C4_HUMAN Protocadherin 7 OS=Homo sapiens OX=9606 GN=PCDH7 PE=1 SV=2
2	A0A0A6YW34	751	379	0.341	0.963	A0A0A6YW34_MOUSE Protocadherin 7 (Fragment) OS=Mus musculus OX=10090 GN=Pcdh7 PE=1 SV=1
3	A0A0A6YWK0	602	1026	0.364	0.379	A0A0A6YWK0_MOUSE Protocadherin 11 X-linked OS=Mus musculus OX=10090 GN=Pcdh11x PE=1 SV=1
4	A0A0A6YWM0	586	873	0.349	0.427	A0A0A6YWM0_MOUSE Protocadherin 9 (Fragment) OS=Mus musculus OX=10090 GN=Pcdh9 PE=1 SV=1
5	A0A0A6YWY8	655	1203	0.398	0.353	A0A0A6YWY8_MOUSE Protocadherin 9 OS=Mus musculus OX=10090 GN=Pcdh9 PE=1 SV=1
6	A0A0A6YY09	655	1195	0.398	0.356	A0A0A6YY09_MOUSE Protocadherin 9 OS=Mus musculus OX=10090 GN=Pcdh9 PE=1 SV=1
7	A0A0A6YY37	600	1038	0.355	0.365	A0A0A6YY37_MOUSE Protocadherin 9 OS=Mus musculus OX=10090 GN=Pcdh9 PE=1 SV=1
8	A0A0A6YY48	1442	802	0.659	0.879	A0A0A6YY48_MOUSE Protocadherin 7 (Fragment) OS=Mus musculus OX=10090 GN=Pcdh7 PE=1 SV=1
9	A0A0A6YY83	2114	1255	0.964	0.822	A0A0A6YY83_MOUSE Protocadherin 7 OS=Mus musculus OX=10090 GN=Pcdh7 PE=1 SV=1
10	A0A8I5ZK96	659	1237	0.399	0.345	A0A8I5ZK96_RAT Protocadherin 9 OS=Rattus norvegicus OX=10116 GN=Pcdh9 PE=4 SV=1
11	A0JNT1	602	1128	0.364	0.345	A0JNT1_MOUSE Pcdh11x protein OS=Mus musculus OX=10090 GN=Pcdh11x PE=1 SV=1
12	A2RS43	2136	1069	0.974	0.974	A2RS43_MOUSE Protocadherin 7 OS=Mus musculus OX=10090 GN=Pcdh7 PE=1 SV=1
13	B1AZR7	602	1320	0.361	0.292	B1AZR7_MOUSE Protocadherin 11 X-linked OS=Mus musculus OX=10090 GN=Pcdh11x PE=1 SV=1
14	B2RXR7	655	1161	0.398	0.366	B2RXR7_MOUSE Pcdh9 protein OS=Mus musculus OX=10090 GN=Pcdh9 PE=2 SV=1
15	B2RY66	655	1203	0.398	0.353	B2RY66_MOUSE Pcdh9 protein OS=Mus musculus OX=10090 GN=Pcdh9 PE=2 SV=1
16	B2RY69	655	1237	0.398	0.344	B2RY69_MOUSE Protocadherin 9 OS=Mus musculus OX=10090 GN=Pcdh9 PE=2 SV=1
17	E9Q2S0	2115	1247	0.964	0.827	E9Q2S0_MOUSE Protocadherin 7 OS=Mus musculus OX=10090 GN=Pcdh7 PE=1 SV=2
18	E9Q622	603	1334	0.361	0.289	E9Q622_MOUSE Protocadherin 11 X-linked OS=Mus musculus OX=10090 GN=Pcdh11x PE=1 SV=1
19	F1LS01	659	1203	0.399	0.355	F1LS01_RAT Protocadherin 9 OS=Rattus norvegicus OX=10116 GN=Pcdh9 PE=4 SV=4
20	F6ZNL5	602	1338	0.361	0.288	F6ZNL5_MOUSE Protocadherin 11 X-linked OS=Mus musculus OX=10090 GN=Pcdh11x PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02439 Adeno_E3_CR2	3.6e+02	12.3	Adenovirus E3 region protein CR2
2	PF00028 Cadherin	1.3e-106	360.6	Cadherin domain
3	PF08266 Cadherin_2	7.4e-14	62.7	Cadherin-like
4	PF16184 Cadherin_3	55	15.1	Cadherin-like
5	PF08758 Cadherin_pro	8.8	17.9	Cadherin prodomain like
6	PF14575 EphA2_TM	2.5e+02	13.8	Ephrin type-A receptor 2 transmembrane domain
7	PF15686 LYRIC	49	14.8	Lysine-rich CEACAM1 co-isolated protein family
8	PF04478 Mid2	12	17.1	Mid2 like cell wall stress sensor
9	PF14991 MLANA	94	14.7	Protein melan-A
10	PF08374 Protocadherin	8.2e-82	286.0	Protocadherin
11	PF15102 TMEM154	80	14.5	TMEM154 protein family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000027496

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000031686	0.723	Gap junction protein
2	9598.ENSPTRP00000009251	0.711	Protein phosphatase 1, catalytic subunit, alpha isozyme
3	9598.ENSPTRP00000010728	0.674	Cyclin-dependent kinase-like 1 (CDC2-related kinase)
4	9598.ENSPTRP00000031112	0.669	Uncharacterized protein
5	9598.ENSPTRP00000024764	0.668	GTP binding protein 1
6	9598.ENSPTRP00000003607	0.632	Nidogen 1
7	9598.ENSPTRP00000012439	0.605	Uncharacterized protein
8	9598.ENSPTRP00000044466	0.597	Catenin (Cadherin-associated protein), beta 1, 88kDa
9	9598.ENSPTRP00000053542	0.589	Family with sequence similarity 192, member A
10	9598.ENSPTRP00000027493	0.588	Uncharacterized protein
11	9598.ENSPTRP00000034834	0.584	Peptidase inhibitor 15
12	9598.ENSPTRP00000021726	0.577	Protein phosphatase 1, regulatory (inhibitor) subunit 1C
13	9598.ENSPTRP00000028673	0.572	Uncharacterized protein
14	9598.ENSPTRP00000056162	0.572	Uncharacterized protein
15	9598.ENSPTRP00000006932	0.563	Uncharacterized protein
16	9598.ENSPTRP00000006930	0.556	Folate receptor 1 (adult)
17	9598.ENSPTRP00000009954	0.540	Uncharacterized protein
18	9598.ENSPTRP00000027637	0.534	Uncharacterized protein
19	9598.ENSPTRP00000001085	0.527	Uncharacterized protein
20	9598.ENSPTRP00000026114	0.520	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0007155	0.979	cell adhesion
GO:0032502	0.732	developmental process
GO:0048856	0.626	anatomical structure development
GO:0065007	0.550	biological regulation
GO:0050789	0.543	regulation of biological process
GO:0050896	0.369	response to stimulus
GO:0050794	0.365	regulation of cellular process
GO:0032501	0.344	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.941	intracellular anatomical structure
GO:0005737	0.907	cytoplasm
GO:0043231	0.855	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]