StarFunc result for job id O60258

User Input

>input (216 residues)
MGAARLLPNLTLCLQLLILCCQTQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSR
TSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKP
SGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQ
GQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60258	1.000	1.000	1.159E-42	216	1.000	1.000	O60258.pdb.gz	FGF17_HUMAN Fibroblast growth factor 17 OS=Homo sapiens OX=9606 GN=FGF17 PE=1 SV=1
2	AFDB:Q6SJP8	0.765	0.768	5.417E-31	215	0.653	0.656	Q6SJP8.pdb.gz	FG17_DANRE Fibroblast growth factor 17 OS=Danio rerio OX=7955 GN=fgf17 PE=2 SV=1
3	AFDB:P55075	0.697	0.647	1.054E-28	233	0.602	0.558	P55075.pdb.gz	FGF8_HUMAN Fibroblast growth factor 8 OS=Homo sapiens OX=9606 GN=FGF8 PE=1 SV=1
4	AFDB:Q4R0X9	0.776	0.783	2.636E-28	214	0.588	0.593	Q4R0X9.pdb.gz	Q4R0X9_CHICK Fibroblast growth factor OS=Gallus gallus OX=9031 GN=FGF8 PE=3 SV=1
5	AFDB:Q8AXC5	0.774	0.791	3.718E-28	211	0.588	0.602	Q8AXC5.pdb.gz	Q8AXC5_XENLA Fibroblast growth factor OS=Xenopus laevis OX=8355 GN=fgf8.L PE=2 SV=1
6	AFDB:O57341	0.752	0.772	1.557E-27	210	0.574	0.590	O57341.pdb.gz	FGF8A_DANRE Fibroblast growth factor 8 OS=Danio rerio OX=7955 GN=fgf8a PE=2 SV=1
7	AFDB:P37237	0.686	0.555	4.367E-27	268	0.616	0.496	P37237.pdb.gz	FGF8_MOUSE Fibroblast growth factor 8 OS=Mus musculus OX=10090 GN=Fgf8 PE=1 SV=1
8	AFDB:O76093	0.726	0.756	5.816E-27	207	0.514	0.536	O76093.pdb.gz	FGF18_HUMAN Fibroblast growth factor 18 OS=Homo sapiens OX=9606 GN=FGF18 PE=1 SV=1
9	AFDB:Q0IIQ7	0.752	0.779	2.383E-24	208	0.444	0.462	Q0IIQ7.pdb.gz	Q0IIQ7_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=si:zc207o21.1 PE=2 SV=1
10	AFDB:P08620	0.570	0.597	2.019E-14	206	0.222	0.233	P08620.pdb.gz	FGF4_HUMAN Fibroblast growth factor 4 OS=Homo sapiens OX=9606 GN=FGF4 PE=1 SV=1
11	PDB:4jq0A	0.537	0.810	1.762E-10	141	0.125	0.191	4jq0A.pdb.gz	Structural analyses of Ca(2+)/CaM interaction with NaV channel C-termini reveal mechanisms of calcium-dependent regulation.
12	PDB:3f1rA	0.543	0.741	1.975E-10	157	0.185	0.255	3f1rA.pdb.gz	Homodimerization controls the fibroblast growth factor 9 subfamily's receptor binding and heparan sulfate-dependent diffusion in the extracellular matrix
13	PDB:1ry7A	0.566	0.798	3.929E-10	151	0.148	0.212	1ry7A.pdb.gz
14	PDB:6b0tA	0.489	0.228	7.921E-6	487	0.093	0.041	6b0tA.pdb.gz	Structural Insights into the Induced-fit Inhibition of Fascin by a Small-Molecule Inhibitor.
15	PDB:4qd2B	0.498	0.722	2.958E-5	143	0.083	0.126	4qd2B.pdb.gz	Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex.
16	PDB:4qd2C	0.526	0.403	1.312E-4	286	0.065	0.049	4qd2C.pdb.gz	Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex.
17	PDB:1t9fA	0.466	0.557	1.960E-4	178	0.074	0.090	1t9fA.pdb.gz
18	PDB:2d43A	0.458	0.219	2.327E-4	482	0.088	0.039	2d43A.pdb.gz	The family 42 carbohydrate-binding module of family 54 alpha-L-arabinofuranosidase specifically binds the arabinofuranose side chain of hemicellulose
19	PDB:4iybA	0.480	0.713	3.475E-4	140	0.088	0.136	4iybA.pdb.gz	Macrolepiota procera ricin B-like lectin (MPL) in complex with galactose
20	PDB:3malA	0.405	0.474	4.127E-4	181	0.065	0.077	3malA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60258	1.46e-163	451	216	1.000	1.000	FGF17_HUMAN Fibroblast growth factor 17 OS=Homo sapiens OX=9606 GN=FGF17 PE=1 SV=1
2	P63075	4.84e-161	445	216	0.986	0.986	FGF17_MOUSE Fibroblast growth factor 17 OS=Mus musculus OX=10090 GN=Fgf17 PE=2 SV=1
3	Q6SJP8	1.91e-106	306	215	0.653	0.656	FG17_DANRE Fibroblast growth factor 17 OS=Danio rerio OX=7955 GN=fgf17 PE=2 SV=1
4	Q8AXC5	2.38e-88	261	211	0.588	0.602	Q8AXC5_XENLA Fibroblast growth factor OS=Xenopus laevis OX=8355 GN=fgf8.L PE=2 SV=1
5	Q90696	2.39e-86	255	204	0.579	0.613	Q90696_CHICK Fibroblast growth factor (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
6	Q90722	3.03e-86	256	214	0.579	0.584	FGF8_CHICK Fibroblast growth factor 8 OS=Gallus gallus OX=9031 GN=FGF8 PE=2 SV=1
7	Q4R0X9	4.15e-86	255	214	0.579	0.584	Q4R0X9_CHICK Fibroblast growth factor OS=Gallus gallus OX=9031 GN=FGF8 PE=3 SV=1
8	A0A8I5ZL19	2.25e-82	247	244	0.569	0.504	A0A8I5ZL19_RAT Fibroblast growth factor OS=Rattus norvegicus OX=10116 GN=Fgf8 PE=3 SV=1
9	O57341	3.43e-82	245	210	0.574	0.590	FGF8A_DANRE Fibroblast growth factor 8 OS=Danio rerio OX=7955 GN=fgf8a PE=2 SV=1
10	C4P6Q2	3.51e-80	239	175	0.514	0.634	C4P6Q2_CHICK Fibroblast growth factor (Fragment) OS=Gallus gallus OX=9031 GN=FGF8 PE=2 SV=1
11	Q76LI5	2.81e-79	238	204	0.551	0.583	Q76LI5_RAT Fibroblast growth factor OS=Rattus norvegicus OX=10116 GN=Fgf8 PE=2 SV=1
12	P55075	1.37e-78	237	233	0.551	0.511	FGF8_HUMAN Fibroblast growth factor 8 OS=Homo sapiens OX=9606 GN=FGF8 PE=1 SV=1
13	A0A8I6B5D5	2.29e-77	235	268	0.546	0.440	A0A8I6B5D5_RAT Fibroblast growth factor OS=Rattus norvegicus OX=10116 GN=Fgf8 PE=3 SV=1
14	A0A8J8XTJ6	2.47e-77	232	189	0.537	0.614	A0A8J8XTJ6_RAT Fibroblast growth factor OS=Rattus norvegicus OX=10116 GN=Fgf8 PE=3 SV=1
15	P37237	2.70e-77	235	268	0.546	0.440	FGF8_MOUSE Fibroblast growth factor 8 OS=Mus musculus OX=10090 GN=Fgf8 PE=1 SV=1
16	O89101	4.43e-70	214	207	0.477	0.498	FGF18_MOUSE Fibroblast growth factor 18 OS=Mus musculus OX=10090 GN=Fgf18 PE=2 SV=1
17	O88182	2.30e-69	213	207	0.472	0.493	FGF18_RAT Fibroblast growth factor 18 OS=Rattus norvegicus OX=10116 GN=Fgf18 PE=2 SV=1
18	O76093	2.80e-69	212	207	0.472	0.493	FGF18_HUMAN Fibroblast growth factor 18 OS=Homo sapiens OX=9606 GN=FGF18 PE=1 SV=1
19	Q0IIQ7	5.20e-67	206	208	0.468	0.486	Q0IIQ7_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=si:zc207o21.1 PE=2 SV=1
20	P21781	9.34e-15	71.6	194	0.213	0.237	FGF7_HUMAN Fibroblast growth factor 7 OS=Homo sapiens OX=9606 GN=FGF7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06268 Fascin	1.6e+02	13.9	Fascin domain
2	PF00167 FGF	3.4e-37	138.6	Fibroblast growth factor
3	PF00340 IL1	5.7e+02	11.6	Interleukin-1 / 18

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010363642.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010378799.1	0.923	Fibroblast growth factor receptor 2 isoform X1
2	61622.XP_010382646.1	0.904	Fibroblast growth factor receptor 3 isoform X1
3	61622.XP_010384710.1	0.903	Fibroblast growth factor receptor 4
4	61622.XP_010361178.1	0.838	Kinase insert domain receptor
5	61622.XP_010360720.1	0.832	Belongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily.
6	61622.XP_010357283.1	0.823	KIT proto-oncogene receptor tyrosine kinase
7	61622.XP_010360648.1	0.823	Fms related tyrosine kinase 1
8	61622.XP_010383576.1	0.816	Fibroblast growth factor receptor 1
9	61622.XP_010373326.1	0.797	Fms related tyrosine kinase 4
10	61622.XP_010382757.1	0.794	TEK receptor tyrosine kinase
11	61622.XP_010378850.1	0.787	Epidermal growth factor receptor isoform X1
12	61622.XP_010371930.1	0.775	Platelet-derived growth factor receptor beta
13	61622.XP_010357288.1	0.754	Platelet-derived growth factor receptor alpha
14	61622.XP_010387372.1	0.750	EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR and activation of the magnesium channel TRPM6
15	61622.XP_010380410.1	0.749	Belongs to the heparin-binding growth factors family.
16	61622.XP_010387646.1	0.748	MET proto-oncogene, receptor tyrosine kinase
17	61622.XP_010377602.1	0.730	Erb-b2 receptor tyrosine kinase 2
18	61622.XP_010371929.1	0.725	Belongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily.
19	61622.XP_010386568.1	0.700	Fibroblast growth factor 1 isoform X1
20	61622.XP_010376118.1	0.699	Receptor tyrosine-protein kinase erbB-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005104	1.000	fibroblast growth factor receptor binding
GO:0008083	1.000	growth factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.999	response to stimulus
GO:0009987	0.999	cellular process
GO:0007154	0.994	cell communication
GO:0023052	0.993	signaling
GO:0050794	0.992	regulation of cellular process
GO:0032502	0.986	developmental process
GO:0032501	0.977	multicellular organismal process
GO:0048518	0.976	positive regulation of biological process
GO:0048856	0.975	anatomical structure development
GO:0051716	0.969	cellular response to stimulus
GO:0007275	0.927	multicellular organism development
GO:0007165	0.875	signal transduction
GO:0048522	0.874	positive regulation of cellular process
GO:0048731	0.793	system development
GO:0007169	0.780	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0070848	0.763	response to growth factor
GO:0019222	0.677	regulation of metabolic process
GO:0042127	0.663	regulation of cell population proliferation
GO:0071495	0.644	cellular response to endogenous stimulus
GO:0071363	0.628	cellular response to growth factor stimulus
GO:0071774	0.546	response to fibroblast growth factor
GO:0008284	0.540	positive regulation of cell population proliferation
GO:0007399	0.519	nervous system development
GO:0009893	0.435	positive regulation of metabolic process
GO:0060255	0.418	regulation of macromolecule metabolic process
GO:0031323	0.385	regulation of cellular metabolic process
GO:0044344	0.385	cellular response to fibroblast growth factor stimulus
GO:0080090	0.370	regulation of primary metabolic process
GO:0051171	0.350	regulation of nitrogen compound metabolic process
GO:0048583	0.335	regulation of response to stimulus
GO:0010604	0.332	positive regulation of macromolecule metabolic process
GO:0010646	0.319	regulation of cell communication
GO:0048519	0.310	negative regulation of biological process
GO:0042221	0.307	response to chemical
GO:0023051	0.305	regulation of signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.997	extracellular space
GO:0016020	0.957	membrane
GO:0071944	0.947	cell periphery
GO:0005886	0.928	plasma membrane
GO:0043226	0.822	organelle
GO:0043231	0.788	intracellular membrane-bounded organelle
GO:0005737	0.751	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]