StarFunc result for job id O60260

User Input

>input (465 residues)
MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCD
LDQQSIVHIVQRPWRKGQEMNATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLA
VILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGP
SCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCIT
CTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVAGCPNSLIKE
LHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGC
GFAFCRECKEAYHEGECSAVFEASGTTTQAYRVDERAAEQARWEAASKETIKKTTKPCPR
CHVPVEKNGGCMHMKCPQPQCRLEWCWNCGCEWNRVCMGDHWFDV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60260	1.000	1.000	3.278E-98	465	1.000	1.000	O60260.pdb.gz	PRKN_HUMAN E3 ubiquitin-protein ligase parkin OS=Homo sapiens OX=9606 GN=PRKN PE=1 SV=2
2	AFDB:Q9JK66	0.874	0.874	1.071E-87	465	0.852	0.852	Q9JK66.pdb.gz	PRKN_RAT E3 ubiquitin-protein ligase parkin OS=Rattus norvegicus OX=10116 GN=Prkn PE=1 SV=1
3	PDB:4zynB	0.803	0.966	2.291E-68	385	0.744	0.899	4zynB.pdb.gz	A Ubl/ubiquitin switch in the activation of Parkin.
4	AFDB:A0A0H2UKX4	0.435	0.441	1.638E-55	458	0.613	0.622	A0A0H2UKX4.pdb.gz
5	AFDB:Q7KTX7	0.388	0.376	1.088E-43	482	0.417	0.402	Q7KTX7.pdb.gz	PRKN_DROME E3 ubiquitin-protein ligase parkin OS=Drosophila melanogaster OX=7227 GN=park PE=1 SV=1
6	AFDB:Q9XUS3	0.365	0.435	3.556E-33	386	0.269	0.324	Q9XUS3.pdb.gz	Q9XUS3_CAEEL E3 ubiquitin-protein ligase parkin OS=Caenorhabditis elegans OX=6239 GN=pdr-1 PE=1 SV=2
7	PDB:7od1A	0.188	0.200	7.181E-8	430	0.129	0.140	7od1A.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
8	PDB:4kblA	0.165	0.186	2.962E-7	395	0.125	0.147	4kblA.pdb.gz	Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism.
9	AFDB:Q7TMI3	0.152	0.090	4.543E-7	803	0.120	0.070	Q7TMI3.pdb.gz	UHRF2_MOUSE E3 ubiquitin-protein ligase UHRF2 OS=Mus musculus OX=10090 GN=Uhrf2 PE=1 SV=1
10	AFDB:Q9VXF9	0.151	0.154	5.754E-7	458	0.071	0.072	Q9VXF9.pdb.gz	Q9VXF9_DROME AT13091p OS=Drosophila melanogaster OX=7227 GN=rngo PE=1 SV=1
11	AFDB:P59232	0.160	0.450	8.200E-7	157	0.088	0.261	P59232.pdb.gz	R27AB_ARATH Ubiquitin-ribosomal protein eS31y fusion protein OS=Arabidopsis thaliana OX=3702 GN=RPS27AB PE=2 SV=2
12	AFDB:P0C016	0.159	0.471	8.699E-7	150	0.056	0.173	P0C016.pdb.gz	RS27A_SCHPO Ubiquitin-ribosomal protein eS31A fusion protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubi3 PE=1 SV=2
13	AFDB:P15357	0.156	0.449	9.789E-7	156	0.056	0.167	P15357.pdb.gz	RS27A_DROME Ubiquitin-ribosomal protein eS31 fusion protein OS=Drosophila melanogaster OX=7227 GN=RpS27A PE=1 SV=2
14	PDB:5tteB	0.180	0.188	2.633E-6	442	0.120	0.127	5tteB.pdb.gz	Structural insights into the mechanism and E2 specificity of the RBR E3 ubiquitin ligase HHARI.
15	PDB:7b5lH	0.151	0.162	6.774E-6	423	0.123	0.135	7b5lH.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
16	PDB:6ef3u	0.148	0.823	2.794E-5	75	0.054	0.333	6ef3u.pdb.gz	Substrate-engaged 26Sproteasome structures reveal mechanisms for ATP-hydrolysis-driven translocation.
17	PDB:3ai5A	0.145	0.223	5.044E-5	299	0.047	0.074	3ai5A.pdb.gz
18	PDB:3dbhI	0.151	0.750	8.581E-5	86	0.041	0.221	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
19	PDB:6yvaC	0.156	0.452	9.103E-5	155	0.041	0.123	6yvaC.pdb.gz
20	PDB:7rbsB	0.157	0.447	1.024E-4	157	0.043	0.127	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60260	0.0	966	465	1.000	1.000	PRKN_HUMAN E3 ubiquitin-protein ligase parkin OS=Homo sapiens OX=9606 GN=PRKN PE=1 SV=2
2	Q561U2	0.0	591	458	0.624	0.633	Q561U2_DANRE E3 ubiquitin-protein ligase parkin OS=Danio rerio OX=7955 GN=park2 PE=2 SV=1
3	Q9JK66	0.0	832	465	0.852	0.852	PRKN_RAT E3 ubiquitin-protein ligase parkin OS=Rattus norvegicus OX=10116 GN=Prkn PE=1 SV=1
4	Q9WVS6	0.0	814	464	0.837	0.838	PRKN_MOUSE E3 ubiquitin-protein ligase parkin OS=Mus musculus OX=10090 GN=Prkn PE=1 SV=1
5	X5DR79	0.0	966	465	1.000	1.000	X5DR79_HUMAN E3 ubiquitin-protein ligase parkin (Fragment) OS=Homo sapiens OX=9606 GN=PARK2 PE=2 SV=1
6	Q7KTX7	1.07e-128	383	482	0.430	0.415	PRKN_DROME E3 ubiquitin-protein ligase parkin OS=Drosophila melanogaster OX=7227 GN=park PE=1 SV=1
7	A0A087X0Z9	3.60e-128	370	176	0.376	0.994	A0A087X0Z9_HUMAN RBR-type E3 ubiquitin transferase (Fragment) OS=Homo sapiens OX=9606 GN=PRKN PE=1 SV=1
8	Q9XUS3	3.70e-49	174	386	0.275	0.332	Q9XUS3_CAEEL E3 ubiquitin-protein ligase parkin OS=Caenorhabditis elegans OX=6239 GN=pdr-1 PE=1 SV=2
9	Q6T486	2.64e-14	77.4	520	0.140	0.125	RBRA_DICDI Probable E3 ubiquitin-protein ligase rbrA OS=Dictyostelium discoideum OX=44689 GN=rbrA PE=3 SV=1
10	Q94981	3.02e-12	70.9	503	0.148	0.137	ARI1_DROME E3 ubiquitin-protein ligase ariadne-1 OS=Drosophila melanogaster OX=7227 GN=ari-1 PE=1 SV=2
11	Q9Y4X5	4.05e-12	70.5	557	0.114	0.095	ARI1_HUMAN E3 ubiquitin-protein ligase ARIH1 OS=Homo sapiens OX=9606 GN=ARIH1 PE=1 SV=2
12	Q9Z1K5	4.22e-12	70.5	555	0.114	0.095	ARI1_MOUSE E3 ubiquitin-protein ligase ARIH1 OS=Mus musculus OX=10090 GN=Arih1 PE=1 SV=3
13	Q9UBS8	1.17e-10	65.9	474	0.138	0.135	RNF14_HUMAN E3 ubiquitin-protein ligase RNF14 OS=Homo sapiens OX=9606 GN=RNF14 PE=1 SV=1
14	Q9Z1K6	3.31e-10	64.3	492	0.118	0.112	ARI2_MOUSE E3 ubiquitin-protein ligase ARIH2 OS=Mus musculus OX=10090 GN=Arih2 PE=1 SV=1
15	O95376	6.71e-10	63.5	493	0.118	0.112	ARI2_HUMAN E3 ubiquitin-protein ligase ARIH2 OS=Homo sapiens OX=9606 GN=ARIH2 PE=1 SV=1
16	Q6IBL8	6.71e-10	63.5	493	0.118	0.112	Q6IBL8_HUMAN RBR-type E3 ubiquitin transferase OS=Homo sapiens OX=9606 GN=ARIH2 PE=2 SV=1
17	F1RB95	3.38e-09	61.2	459	0.099	0.100	RNF14_DANRE E3 ubiquitin-protein ligase RNF14 OS=Danio rerio OX=7955 GN=rnf14 PE=2 SV=1
18	Q20871	1.36e-08	59.3	437	0.120	0.128	Q20871_CAEEL RBR-type E3 ubiquitin transferase OS=Caenorhabditis elegans OX=6239 GN=CELE_F56D2.5 PE=1 SV=2
19	Q8W468	2.29e-08	58.9	567	0.084	0.069	ARI8_ARATH Probable E3 ubiquitin-protein ligase ARI8 OS=Arabidopsis thaliana OX=3702 GN=ARI8 PE=2 SV=1
20	P59232	2.80e-08	55.1	157	0.052	0.153	R27AB_ARATH Ubiquitin-ribosomal protein eS31y fusion protein OS=Arabidopsis thaliana OX=3702 GN=RPS27AB PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10302 Dsc3_N	2.6e+02	13.6	DSC E3 ubiquitin ligase complex subunit 3, ubiquitin-like domain
2	PF01485 IBR	1.3e-08	46.1	IBR domain, a half RING-finger domain
3	PF11976 Rad60-SLD	0.00016	32.7	Ubiquitin-2 like Rad60 SUMO-like
4	PF13881 Rad60-SLD_2	52	15.4	Ubiquitin-2 like Rad60 SUMO-like
5	PF00240 ubiquitin	1.4e-14	64.9	Ubiquitin family
6	PF17976 zf-RING_12	1.1e-35	133.0	RING/Ubox like zinc-binding domain
7	PF17978 zf-RING_14	2.6e-42	154.4	RING/Ubox like zinc-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355865

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000235329	0.999	Mitofusin-2
2	9606.ENSP00000338345	0.999	Alpha-synuclein
3	9606.ENSP00000364204	0.999	Serine/threonine-protein kinase PINK1, mitochondrial
4	9606.ENSP00000400906	0.999	Ubiquitin-conjugating enzyme E2L 3
5	9606.ENSP00000418770	0.999	Protein/nucleic acid deglycase DJ-1
6	9606.ENSP00000261368	0.998	Synphilin-1
7	9606.ENSP00000306449	0.998	Prosaposin receptor GPR37
8	9606.ENSP00000420617	0.998	Mitofusin-1
9	9606.ENSP00000441543	0.998	Polyubiquitin-C
10	9606.ENSP00000391311	0.997	Septin-5
11	9606.ENSP00000485133	0.997	Ubiquitin-conjugating enzyme E2 that specifically acts with HECT-type and RBR family E3 ubiquitin-protein ligases. Does not function with most RING-containing E3 ubiquitin-protein ligases because it lacks intrinsic E3-independent reactivity with lysine: in contrast, it has activity with the RBR family E3 enzymes, such as PRKN and ARIH1, that function like function like RING-HECT hybrids. Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'-linked polyubiquitination. Involved in the selective degradation of short-live [...]
12	9606.ENSP00000316176	0.996	Ubiquitin-conjugating enzyme E2 N
13	9606.ENSP00000355231	0.996	Beclin-1
14	9606.ENSP00000478320	0.995	Ataxin-3
15	9606.ENSP00000298910	0.994	Leucine-rich repeat serine/threonine-protein kinase 2
16	9606.ENSP00000357879	0.994	26S proteasome non-ATPase regulatory subunit 4
17	9606.ENSP00000379931	0.994	Ubiquitin-conjugating enzyme E2 E2
18	9606.ENSP00000265333	0.993	Voltage-dependent anion-selective channel protein 1
19	9606.ENSP00000304697	0.992	Polyubiquitin-B
20	9606.ENSP00000284320	0.986	Mitochondrial import receptor subunit TOM70

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019787	0.998	ubiquitin-like protein transferase activity
GO:0044877	0.997	protein-containing complex binding
GO:0019900	0.997	kinase binding
GO:0019901	0.994	protein kinase binding
GO:0004842	0.983	ubiquitin-protein transferase activity
GO:0061659	0.956	ubiquitin-like protein ligase activity
GO:0061630	0.949	ubiquitin protein ligase activity
GO:0031624	0.946	ubiquitin conjugating enzyme binding
GO:0031625	0.864	ubiquitin protein ligase binding
GO:0042802	0.852	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.993	biological regulation
GO:0009987	0.993	cellular process
GO:0071704	0.990	organic substance metabolic process
GO:0044238	0.989	primary metabolic process
GO:0044237	0.979	cellular metabolic process
GO:0050896	0.978	response to stimulus
GO:0042981	0.978	regulation of apoptotic process
GO:0006807	0.977	nitrogen compound metabolic process
GO:0051716	0.973	cellular response to stimulus
GO:0043170	0.972	macromolecule metabolic process
GO:0080090	0.969	regulation of primary metabolic process
GO:0051171	0.966	regulation of nitrogen compound metabolic process
GO:0023051	0.959	regulation of signaling
GO:0009893	0.955	positive regulation of metabolic process
GO:0019538	0.955	protein metabolic process
GO:0010646	0.942	regulation of cell communication
GO:0006950	0.941	response to stress
GO:0065008	0.938	regulation of biological quality
GO:0061726	0.937	mitochondrion disassembly
GO:0060255	0.927	regulation of macromolecule metabolic process
GO:0000422	0.926	autophagy of mitochondrion
GO:0009894	0.923	regulation of catabolic process
GO:0048522	0.923	positive regulation of cellular process
GO:0051179	0.911	localization
GO:0048519	0.911	negative regulation of biological process
GO:0031323	0.911	regulation of cellular metabolic process
GO:0070647	0.904	protein modification by small protein conjugation or removal
GO:0048523	0.898	negative regulation of cellular process
GO:0016567	0.894	protein ubiquitination
GO:0048583	0.892	regulation of response to stimulus
GO:0051173	0.885	positive regulation of nitrogen compound metabolic process
GO:0070887	0.878	cellular response to chemical stimulus
GO:0051130	0.867	positive regulation of cellular component organization
GO:0031329	0.866	regulation of cellular catabolic process
GO:0010506	0.862	regulation of autophagy
GO:0010822	0.859	positive regulation of mitochondrion organization
GO:0009966	0.858	regulation of signal transduction
GO:0006979	0.853	response to oxidative stress
GO:0033554	0.853	cellular response to stress
GO:0080135	0.848	regulation of cellular response to stress
GO:0032879	0.844	regulation of localization
GO:0031325	0.844	positive regulation of cellular metabolic process
GO:0009896	0.819	positive regulation of catabolic process
GO:0051641	0.806	cellular localization
GO:1900407	0.772	regulation of cellular response to oxidative stress
GO:0051865	0.764	protein autoubiquitination
GO:0006119	0.756	oxidative phosphorylation
GO:0060341	0.748	regulation of cellular localization
GO:1903146	0.729	regulation of autophagy of mitochondrion
GO:0010823	0.728	negative regulation of mitochondrion organization
GO:0051049	0.725	regulation of transport
GO:0009628	0.709	response to abiotic stimulus
GO:0042773	0.676	ATP synthesis coupled electron transport
GO:0032880	0.656	regulation of protein localization
GO:0010604	0.645	positive regulation of macromolecule metabolic process
GO:0010033	0.638	response to organic substance
GO:0051246	0.622	regulation of protein metabolic process
GO:0010468	0.611	regulation of gene expression
GO:0010647	0.610	positive regulation of cell communication
GO:0032501	0.590	multicellular organismal process
GO:1902531	0.569	regulation of intracellular signal transduction
GO:0051247	0.568	positive regulation of protein metabolic process
GO:0009892	0.546	negative regulation of metabolic process
GO:0030163	0.526	protein catabolic process
GO:0009889	0.517	regulation of biosynthetic process
GO:0070201	0.517	regulation of establishment of protein localization
GO:0051223	0.511	regulation of protein transport
GO:0060548	0.503	negative regulation of cell death
GO:0051046	0.500	regulation of secretion
GO:0031326	0.493	regulation of cellular biosynthetic process
GO:0019646	0.489	aerobic electron transport chain
GO:0051234	0.474	establishment of localization
GO:0031331	0.468	positive regulation of cellular catabolic process
GO:0019219	0.462	regulation of nucleobase-containing compound metabolic process
GO:1903530	0.458	regulation of secretion by cell
GO:0006810	0.453	transport
GO:0023056	0.451	positive regulation of signaling
GO:0007154	0.450	cell communication
GO:0031324	0.406	negative regulation of cellular metabolic process
GO:1901214	0.400	regulation of neuron death
GO:1903201	0.400	regulation of oxidative stress-induced cell death
GO:0023052	0.399	signaling
GO:0048585	0.396	negative regulation of response to stimulus
GO:1903202	0.387	negative regulation of oxidative stress-induced cell death
GO:0031399	0.383	regulation of protein modification process
GO:0043069	0.382	negative regulation of programmed cell death
GO:1903203	0.375	regulation of oxidative stress-induced neuron death
GO:0043066	0.373	negative regulation of apoptotic process
GO:1903829	0.372	positive regulation of protein localization
GO:0044093	0.356	positive regulation of molecular function
GO:0043524	0.351	negative regulation of neuron apoptotic process
GO:0032502	0.348	developmental process
GO:0023057	0.336	negative regulation of signaling
GO:0010648	0.336	negative regulation of cell communication
GO:0050790	0.325	regulation of catalytic activity
GO:0006508	0.316	proteolysis
GO:0050793	0.315	regulation of developmental process
GO:0048584	0.301	positive regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	0.999	nucleus
GO:0005829	0.992	cytosol
GO:0005654	0.992	nucleoplasm
GO:0005739	0.912	mitochondrion
GO:0032991	0.791	protein-containing complex
GO:0042995	0.716	cell projection
GO:0012505	0.698	endomembrane system
GO:0120025	0.694	plasma membrane bounded cell projection
GO:0016604	0.625	nuclear body
GO:0043005	0.621	neuron projection
GO:0016020	0.573	membrane
GO:0005794	0.452	Golgi apparatus
GO:0005783	0.418	endoplasmic reticulum
GO:0048471	0.387	perinuclear region of cytoplasm
GO:0016607	0.356	nuclear speck
GO:0031410	0.318	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.998	Transferases.

[back to server]