StarFunc result for job id O60264

User Input

>input (1052 residues)
MSSAAEPPPPPPPESAPSKPAASIASGGSNSSNKGGPEGVAAQAVASAASAGPADAEMEE
IFDDASPGKQKEIQEPDPTYEEKMQTDRANRFEYLLKQTELFAHFIQPAAQKTPTSPLKM
KPGRPRIKKDEKQNLLSVGDYRHRRTEQEEDEELLTESSKATNVCTRFEDSPSYVKWGKL
RDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIPGPHMVLVPKST
LHNWMSEFKRWVPTLRSVCLIGDKEQRAAFVRDVLLPGEWDVCVTSYEMLIKEKSVFKKF
NWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWSLLNFLLPDVFN
SADDFDSWFDTNNCLGDQKLVERLHMVLRPFLLRRIKADVEKSLPPKKEVKIYVGLSKMQ
REWYTRILMKDIDILNSAGKMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDMHLVT
NSGKMVVLDKLLPKLKEQGSRVLIFSQMTRVLDILEDYCMWRNYEYCRLDGQTPHDERQD
SINAYNEPNSTKFVFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQTK
TVRVFRFITDNTVEERIVERAEMKLRLDSIVIQQGRLVDQNLNKIGKDEMLQMIRHGATH
VFASKESEITDEDIDGILERGAKKTAEMNEKLSKMGESSLRNFTMDTESSVYNFEGEDYR
EKQKIAFTEWIEPPKRERKANYAVDAYFREALRVSEPKAPKAPRPPKQPNVQDFQFFPPR
LFELLEKEILFYRKTIGYKVPRNPELPNAAQAQKEEQLKIDEAESLNDEELEEKEKLLTQ
GFTNWNKRDFNQFIKANEKWGRDDIENIAREVEGKTPEEVIEYSAVFWERCNELQDIEKI
MAQIERGEARIQRRISIKKALDTKIGRYKAPFHQLRISYGTNKGKNYTEEEDRFLICMLH
KLGFDKENVYDELRQCIRNSPQFRFDWFLKSRTAMELQRRCNTLITLIERENMELEEKEK
AEKKKRGPKPSTQKRKMDGAPDGRGRKKKLKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A5WUY4	0.585	0.594	0.000	1036	0.802	0.815	A5WUY4.pdb.gz	A5WUY4_DANRE Probable global transcription activator SNF2L1 OS=Danio rerio OX=7955 GN=si:dkey-148b12.1 PE=1 SV=1
2	AFDB:B7ZLQ5	0.617	0.608	0.000	1070	0.802	0.789	B7ZLQ5.pdb.gz	B7ZLQ5_HUMAN SMARCA1 protein OS=Homo sapiens OX=9606 GN=SMARCA1 PE=1 SV=1
3	AFDB:B8A552	0.759	0.770	0.000	1035	0.851	0.865	B8A552.pdb.gz	B8A552_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Danio rerio OX=7955 GN=chunp6878 PE=1 SV=1
4	AFDB:O60264	1.000	1.000	0.000	1052	1.000	1.000	O60264.pdb.gz	SMCA5_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens OX=9606 GN=SMARCA5 PE=1 SV=1
5	AFDB:P41877	0.664	0.689	0.000	1009	0.590	0.615	P41877.pdb.gz	ISW1_CAEEL Chromatin-remodeling complex ATPase chain isw-1 OS=Caenorhabditis elegans OX=6239 GN=isw-1 PE=1 SV=2
6	AFDB:Q24368	0.830	0.849	0.000	1027	0.691	0.708	Q24368.pdb.gz	ISWI_DROME Chromatin-remodeling complex ATPase chain Iswi OS=Drosophila melanogaster OX=7227 GN=Iswi PE=1 SV=1
7	AFDB:Q5A310	0.695	0.692	8.662E-94	1056	0.470	0.468	Q5A310.pdb.gz	ISW2_CANAL ISWI chromatin-remodeling complex ATPase ISW2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ISW2 PE=2 SV=1
8	AFDB:Q08773	0.576	0.542	5.307E-92	1120	0.476	0.447	Q08773.pdb.gz	ISW2_YEAST ISWI chromatin-remodeling complex ATPase ISW2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ISW2 PE=1 SV=1
9	AFDB:F4JY25	0.553	0.542	1.937E-91	1072	0.526	0.516	F4JY25.pdb.gz	F4JY25_ARATH Chromatin remodeling factor17 OS=Arabidopsis thaliana OX=3702 GN=CHR17 PE=1 SV=1
10	AFDB:P38144	0.650	0.611	2.289E-88	1129	0.455	0.424	P38144.pdb.gz	ISW1_YEAST ISWI chromatin-remodeling complex ATPase ISW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ISW1 PE=1 SV=2
11	PDB:6jylK	0.436	0.883	1.422E-47	504	0.301	0.629	6jylK.pdb.gz	Structures of the ISWI-nucleosome complex reveal a conserved mechanism of chromatin remodeling.
12	PDB:6tdaS	0.404	0.535	6.612E-36	783	0.231	0.310	6tdaS.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
13	PDB:6g0lM	0.379	0.461	1.829E-35	855	0.241	0.297	6g0lM.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
14	PDB:6uxwA	0.412	0.548	2.141E-33	778	0.247	0.334	6uxwA.pdb.gz	Cryo-EM structure of SWI/SNF complex bound to a nucleosome.
15	PDB:7epuB	0.293	0.382	2.459E-33	748	0.222	0.313	7epuB.pdb.gz	Structural basis of ALC1/CHD1L autoinhibition and the mechanism of activation by the nucleosome.
16	PDB:6g0lW	0.394	0.468	6.201E-33	878	0.258	0.309	6g0lW.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
17	PDB:6kw3Y	0.413	0.763	4.528E-32	548	0.231	0.443	6kw3Y.pdb.gz	Structure of the RSC complex bound to the nucleosome.
18	PDB:6gejM	0.391	0.588	4.614E-30	688	0.200	0.305	6gejM.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
19	PDB:7oo3b	0.380	0.701	3.218E-29	534	0.175	0.345	7oo3b.pdb.gz	Structural basis of human transcription-DNA repair coupling.
20	PDB:5vvrM	0.344	0.659	4.020E-25	503	0.156	0.326	5vvrM.pdb.gz	Structural basis for the initiation of eukaryotic transcription-coupled DNA repair.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MRP6	0.0	1735	1058	0.799	0.795	A0A0A0MRP6_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 1 OS=Homo sapiens OX=9606 GN=SMARCA1 PE=1 SV=1
2	A2RUY6	0.0	1788	1028	0.854	0.874	A2RUY6_DANRE SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5 OS=Danio rerio OX=7955 GN=smarca5 PE=2 SV=1
3	A5WUY4	0.0	1700	1036	0.804	0.817	A5WUY4_DANRE Probable global transcription activator SNF2L1 OS=Danio rerio OX=7955 GN=si:dkey-148b12.1 PE=1 SV=1
4	B7ZLQ5	0.0	1728	1070	0.800	0.787	B7ZLQ5_HUMAN SMARCA1 protein OS=Homo sapiens OX=9606 GN=SMARCA1 PE=1 SV=1
5	B8A552	0.0	1788	1035	0.854	0.868	B8A552_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Danio rerio OX=7955 GN=chunp6878 PE=1 SV=1
6	F4JAV9	0.0	1004	1057	0.510	0.508	F4JAV9_ARATH Chromatin-remodeling protein 11 OS=Arabidopsis thaliana OX=3702 GN=CHR11 PE=1 SV=1
7	F4JY24	0.0	1009	1069	0.511	0.503	CHR17_ARATH ISWI chromatin-remodeling complex ATPase CHR17 OS=Arabidopsis thaliana OX=3702 GN=CHR17 PE=1 SV=1
8	F4JY25	0.0	1010	1072	0.511	0.502	F4JY25_ARATH Chromatin remodeling factor17 OS=Arabidopsis thaliana OX=3702 GN=CHR17 PE=1 SV=1
9	O60264	0.0	2185	1052	1.000	1.000	SMCA5_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens OX=9606 GN=SMARCA5 PE=1 SV=1
10	P28370	0.0	1714	1054	0.790	0.788	SMCA1_HUMAN Probable global transcription activator SNF2L1 OS=Homo sapiens OX=9606 GN=SMARCA1 PE=1 SV=2
11	P38144	0.0	901	1129	0.461	0.430	ISW1_YEAST ISWI chromatin-remodeling complex ATPase ISW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ISW1 PE=1 SV=2
12	P41877	0.0	1254	1009	0.596	0.621	ISW1_CAEEL Chromatin-remodeling complex ATPase chain isw-1 OS=Caenorhabditis elegans OX=6239 GN=isw-1 PE=1 SV=2
13	Q08773	0.0	970	1120	0.498	0.468	ISW2_YEAST ISWI chromatin-remodeling complex ATPase ISW2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ISW2 PE=1 SV=1
14	Q24368	0.0	1451	1027	0.692	0.709	ISWI_DROME Chromatin-remodeling complex ATPase chain Iswi OS=Drosophila melanogaster OX=7227 GN=Iswi PE=1 SV=1
15	Q585S8	0.0	560	1160	0.260	0.235	Q585S8_TRYB2 Transcription activator, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=27H14.35 PE=4 SV=1
16	Q5A310	0.0	954	1056	0.469	0.467	ISW2_CANAL ISWI chromatin-remodeling complex ATPase ISW2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ISW2 PE=2 SV=1
17	Q6PGB8	0.0	1724	1046	0.779	0.783	SMCA1_MOUSE Probable global transcription activator SNF2L1 OS=Mus musculus OX=10090 GN=Smarca1 PE=1 SV=1
18	Q8RWY3	0.0	1009	1056	0.509	0.507	ISW2_ARATH ISWI chromatin-remodeling complex ATPase CHR11 OS=Arabidopsis thaliana OX=3702 GN=CHR11 PE=1 SV=4
19	Q91ZW3	0.0	2136	1051	0.976	0.977	SMCA5_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Mus musculus OX=10090 GN=Smarca5 PE=1 SV=1
20	F4J9M5	8.18e-151	479	1102	0.231	0.221	CHR12_ARATH Probable ATP-dependent DNA helicase CHR12 OS=Arabidopsis thaliana OX=3702 GN=CHR12 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13892 DBINO	0.35	22.7	DNA-binding domain
2	PF00270 DEAD	0.0085	27.4	DEAD/DEAH box helicase
3	PF09110 HAND	3e-26	103.7	HAND
4	PF11496 HDA2-3	0.14	22.9	Class II histone deacetylase complex subunits 2 and 3
5	PF00271 Helicase_C	2.1e-16	71.6	Helicase conserved C-terminal domain
6	PF00249 Myb_DNA-binding	0.38	22.3	Myb-like DNA-binding domain
7	PF04851 ResIII	1.4e-07	43.2	Type III restriction enzyme, res subunit
8	PF09111 SLIDE	7.1e-43	156.7	SLIDE
9	PF00176 SNF2-rel_dom	1.7e-81	285.2	SNF2-related domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000283131

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000307208	0.999	Nucleosome-remodeling factor subunit BPTF
2	9606.ENSP00000311513	0.999	Remodeling and spacing factor 1
3	9606.ENSP00000342434	0.999	Tyrosine-protein kinase BAZ1B
4	9606.ENSP00000353458	0.999	Bromodomain adjacent to zinc finger domain protein 1A
5	9606.ENSP00000446880	0.999	Bromodomain adjacent to zinc finger domain protein 2A
6	9606.ENSP00000362592	0.998	Histone-binding protein RBBP4
7	9606.ENSP00000341219	0.997	Cat eye syndrome critical region protein 2
8	9606.ENSP00000220913	0.996	Chromatin accessibility complex protein 1
9	9606.ENSP00000244537	0.994	Histone cluster 1 H4 family member f
10	9606.ENSP00000363286	0.994	DNA polymerase epsilon subunit 3
11	9606.ENSP00000430432	0.992	Histone deacetylase 2
12	9606.ENSP00000362649	0.985	Histone deacetylase 1
13	9606.ENSP00000337332	0.978	NAD-dependent protein deacetylase sirtuin-6
14	9606.ENSP00000369424	0.974	Histone-binding protein RBBP7
15	9606.ENSP00000360162	0.961	Probable global transcription activator SNF2L1
16	9606.ENSP00000320898	0.957	E3 ubiquitin-protein ligase RNF168
17	9606.ENSP00000367034	0.957	Histone cluster 1 H4 family member c
18	9606.ENSP00000484789	0.956	Histone H4
19	9606.ENSP00000378402	0.946	Paired amphipathic helix protein Sin3a
20	9606.ENSP00000347168	0.943	Histone cluster 1 H4 family member j

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008094	1.000	ATP-dependent activity, acting on DNA
GO:1901363	0.999	heterocyclic compound binding
GO:0097159	0.999	organic cyclic compound binding
GO:0003676	0.989	nucleic acid binding
GO:0140658	0.967	ATP-dependent chromatin remodeler activity
GO:0003677	0.964	DNA binding
GO:0016887	0.952	ATP hydrolysis activity
GO:1901265	0.886	nucleoside phosphate binding
GO:0000166	0.884	nucleotide binding
GO:0004386	0.843	helicase activity
GO:0043565	0.496	sequence-specific DNA binding
GO:0140751	0.440	histone octamer slider activity
GO:0030554	0.358	adenyl nucleotide binding
GO:0043167	0.355	ion binding
GO:0043168	0.349	anion binding
GO:0032555	0.348	purine ribonucleotide binding
GO:0003682	0.334	chromatin binding
GO:0035639	0.325	purine ribonucleoside triphosphate binding
GO:0005524	0.317	ATP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0060255	0.997	regulation of macromolecule metabolic process
GO:0080090	0.995	regulation of primary metabolic process
GO:0009987	0.994	cellular process
GO:0019219	0.992	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.968	regulation of gene expression
GO:0071840	0.954	cellular component organization or biogenesis
GO:0009889	0.951	regulation of biosynthetic process
GO:0051252	0.945	regulation of RNA metabolic process
GO:0048518	0.944	positive regulation of biological process
GO:0016043	0.944	cellular component organization
GO:0006355	0.936	regulation of DNA-templated transcription
GO:0006338	0.879	chromatin remodeling
GO:0048522	0.865	positive regulation of cellular process
GO:0009893	0.778	positive regulation of metabolic process
GO:0008152	0.757	metabolic process
GO:0071704	0.743	organic substance metabolic process
GO:0010604	0.741	positive regulation of macromolecule metabolic process
GO:0051173	0.735	positive regulation of nitrogen compound metabolic process
GO:0045935	0.726	positive regulation of nucleobase-containing compound metabolic process
GO:0045893	0.695	positive regulation of DNA-templated transcription
GO:0043170	0.649	macromolecule metabolic process
GO:0044238	0.633	primary metabolic process
GO:0006807	0.618	nitrogen compound metabolic process
GO:0050896	0.468	response to stimulus
GO:0044237	0.446	cellular metabolic process
GO:0048519	0.443	negative regulation of biological process
GO:0048523	0.411	negative regulation of cellular process
GO:0006357	0.373	regulation of transcription by RNA polymerase II
GO:0090304	0.362	nucleic acid metabolic process
GO:0032502	0.313	developmental process
GO:0051716	0.307	cellular response to stimulus
GO:0010605	0.301	negative regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0000785	0.999	chromatin
GO:0140513	0.995	nuclear protein-containing complex
GO:1904949	0.985	ATPase complex
GO:0070603	0.984	SWI/SNF superfamily-type complex
GO:0031010	0.964	ISWI-type complex
GO:0005737	0.644	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:13065	0.952	ATP + H2O = ADP + H(+) + phosphate

[back to server]