StarFunc result for job id O60271

User Input

>input (1321 residues)
MELEDGVVYQEEPGGSGAVMSERVSGLAGSIYREFERLIGRYDEEVVKELMPLVVAVLEN
LDSVFAQDQEHQVELELLRDDNEQLITQYEREKALRKHAEEKFIEFEDSQEQEKKDLQTR
VESLESQTRQLELKAKNYADQISRLEEREAELKKEYNALHQRHTEMIHNYMEHLERTKLH
QLSGSDQLESTAHSRIRKERPISLGIFPLPAGDGLLTPDAQKGGETPGSEQWKFQELSQP
RSHTSLKVSNSPEPQKAVEQEDELSDVSQGGSKATTPASTANSDVATIPTDTPLKEENEG
FVKVTDAPNKSEISKHIEVQVAQETRNVSTGSAENEEKSEVQAIIESTPELDMDKDLSGY
KGSSTPTKGIENKAFDRNTESLFEELSSAGSGLIGDVDEGADLLGMGREVENLILENTQL
LETKNALNIVKNDLIAKVDELTCEKDVLQGELEAVKQAKLKLEEKNRELEEELRKARAEA
EDARQKAKDDDDSDIPTAQRKRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASRE
NPAMQEKKRSSIWQFFSRLFSSSSNTTKKPEPPVNLKYNAPTSHVTPSVKKRSSTLSQLP
GDKSKAFDFLSEETEASLASRREQKREQYRQVKAHVQKEDGRVQAFGWSLPQKYKQVTNG
QGENKMKNLPVPVYLRPLDEKDTSMKLWCAVGVNLSGGKTRDGGSVVGASVFYKDVAGLD
TEGSKQRSASQSSLDKLDQELKEQQKELKNQEELSSLVWICTSTHSATKVLIIDAVQPGN
ILDSFTVCNSHVLCIASVPGARETDYPAGEDLSESGQVDKASLCGSMTSNSSAETDSLLG
GITVVGCSAEGVTGAATSPSTNGASPVMDKPPEMEAENSEVDENVPTAEEATEATEGNAG
SAEDTVDISQTGVYTEHVFTDPLGVQIPEDLSPVYQSSNDSDAYKDQISVLPNEQDLVRE
EAQKMSSLLPTMWLGAQNGCLYVHSSVAQWRKCLHSIKLKDSILSIVHVKGIVLVALADG
TLAIFHRGVDGQWDLSNYHLLDLGRPHHSIRCMTVVHDKVWCGYRNKIYVVQPKAMKIEK
SFDAHPRKESQVRQLAWVGDGVWVSIRLDSTLRLYHAHTYQHLQDVDIEPYVSKMLGTGK
LGFSFVRITALMVSCNRLWVGTGNGVIISIPLTETNKTSGVPGNRPGSVIRVYGDENSDK
VTPGTFIPYCSMAHAQLCFHGHRDAVKFFVAVPGQVISPQSSSSGTDLTGDKAGPSAQEP
GSQTPLKSMLVISGGEGYIDFRMGDEGGESELLGEDLPLEPSVTKAERSHLIVWQVMYGN
E

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K6E8	0.459	0.448	0.000	1352	0.955	0.933	A0A0G2K6E8.pdb.gz	A0A0G2K6E8_RAT Sperm associated antigen 9 OS=Rattus norvegicus OX=10116 GN=Spag9 PE=1 SV=1
2	AFDB:E9QGL9	0.415	0.418	0.000	1313	0.557	0.561	E9QGL9.pdb.gz
3	AFDB:Q9ESN9	0.397	0.392	0.000	1337	0.587	0.580	Q9ESN9.pdb.gz	JIP3_MOUSE C-Jun-amino-terminal kinase-interacting protein 3 OS=Mus musculus OX=10090 GN=Mapk8ip3 PE=1 SV=1
4	AFDB:Q9GQF1	0.372	0.398	2.196E-92	1227	0.411	0.443	Q9GQF1.pdb.gz	JIP3_DROME JNK-interacting protein 3 OS=Drosophila melanogaster OX=7227 GN=syd PE=1 SV=1
5	AFDB:P34609	0.361	0.396	7.897E-80	1190	0.347	0.385	P34609.pdb.gz	JIP_CAEEL JNK-interacting protein OS=Caenorhabditis elegans OX=6239 GN=unc-16 PE=1 SV=4
6	AFDB:O15013	0.255	0.246	1.978E-27	1369	0.090	0.087	O15013.pdb.gz	ARHGA_HUMAN Rho guanine nucleotide exchange factor 10 OS=Homo sapiens OX=9606 GN=ARHGEF10 PE=1 SV=4
7	AFDB:M9PHU0	0.223	0.132	4.718E-20	2263	0.143	0.084	M9PHU0.pdb.gz	M9PHU0_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=CG12432 PE=1 SV=1
8	AFDB:Q9H2Y7	0.138	0.099	3.669E-11	1883	0.120	0.084	Q9H2Y7.pdb.gz	ZN106_HUMAN Zinc finger protein 106 OS=Homo sapiens OX=9606 GN=ZNF106 PE=1 SV=1
9	PDB:7ajuCH	0.157	0.420	1.954E-10	467	0.031	0.088	7ajuCH.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
10	PDB:7mq8LN	0.142	0.267	2.709E-10	671	0.032	0.063	7mq8LN.pdb.gz	Nucleolar maturation of the human small subunit processome.
11	AFDB:P16649	0.158	0.269	4.741E-10	713	0.094	0.174	P16649.pdb.gz	TUP1_YEAST General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TUP1 PE=1 SV=2
12	PDB:7apkF	0.144	0.508	6.474E-10	337	0.035	0.136	7apkF.pdb.gz
13	AFDB:Q86YC2	0.124	0.137	8.172E-10	1186	0.106	0.118	Q86YC2.pdb.gz	PALB2_HUMAN Partner and localizer of BRCA2 OS=Homo sapiens OX=9606 GN=PALB2 PE=1 SV=1
14	PDB:6xr4A	0.149	0.187	1.178E-9	1040	0.042	0.053	6xr4A.pdb.gz
15	PDB:3acpA	0.131	0.377	4.122E-9	417	0.026	0.084	3acpA.pdb.gz
16	PDB:6ttuT	0.132	0.416	4.596E-9	394	0.026	0.086	6ttuT.pdb.gz	NEDD8 nucleates a multivalent cullin-RING-UBE2D ubiquitin ligation assembly.
17	PDB:5jpqY	0.151	0.499	5.125E-9	365	0.031	0.112	5jpqY.pdb.gz	Architecture of the 90S Pre-ribosome: A Structural View on the Birth of the Eukaryotic Ribosome.
18	PDB:7mq8SG	0.140	0.417	6.729E-9	389	0.032	0.108	7mq8SG.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:5o9zL	0.141	0.375	8.366E-9	459	0.031	0.089	5o9zL.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
20	PDB:2h9lA	0.128	0.484	1.040E-8	321	0.029	0.118	2h9lA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K6E8	0.0	2512	1352	0.956	0.934	A0A0G2K6E8_RAT Sperm associated antigen 9 OS=Rattus norvegicus OX=10116 GN=Spag9 PE=1 SV=1
2	A0A8I5Y1R0	0.0	2457	1305	0.936	0.947	A0A8I5Y1R0_RAT Sperm associated antigen 9 OS=Rattus norvegicus OX=10116 GN=Spag9 PE=1 SV=1
3	A0A8I5ZJK4	0.0	2529	1334	0.960	0.951	A0A8I5ZJK4_RAT Sperm associated antigen 9 OS=Rattus norvegicus OX=10116 GN=Spag9 PE=1 SV=1
4	A0A8I6A5S1	0.0	2145	1178	0.813	0.912	A0A8I6A5S1_RAT Sperm associated antigen 9 OS=Rattus norvegicus OX=10116 GN=Spag9 PE=1 SV=1
5	A0A8I6AXC7	0.0	2457	1305	0.937	0.949	A0A8I6AXC7_RAT Sperm associated antigen 9 OS=Rattus norvegicus OX=10116 GN=Spag9 PE=1 SV=1
6	A0A8I6B3N0	0.0	2539	1321	0.960	0.960	A0A8I6B3N0_RAT Sperm associated antigen 9 OS=Rattus norvegicus OX=10116 GN=Spag9 PE=1 SV=1
7	A0A8I6B484	0.0	2104	1169	0.804	0.908	A0A8I6B484_RAT Sperm associated antigen 9 OS=Rattus norvegicus OX=10116 GN=Spag9 PE=1 SV=1
8	E9PSJ4	0.0	2492	1324	0.951	0.949	E9PSJ4_RAT Sperm associated antigen 9 OS=Rattus norvegicus OX=10116 GN=Spag9 PE=1 SV=3
9	E9PSK7	0.0	1434	1322	0.590	0.590	JIP3_RAT C-Jun-amino-terminal kinase-interacting protein 3 OS=Rattus norvegicus OX=10116 GN=Mapk8ip3 PE=1 SV=2
10	L7RKJ8	0.0	1302	1299	0.569	0.578	L7RKJ8_DANRE C-Jun-amino-terminal kinase-interacting protein 3 OS=Danio rerio OX=7955 GN=mapk8ip3 PE=2 SV=1
11	O60271	0.0	2729	1321	1.000	1.000	JIP4_HUMAN C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9 PE=1 SV=4
12	Q58A65	0.0	2640	1321	0.965	0.965	JIP4_MOUSE C-Jun-amino-terminal kinase-interacting protein 4 OS=Mus musculus OX=10090 GN=Spag9 PE=1 SV=2
13	Q9ESN9	0.0	1430	1337	0.593	0.586	JIP3_MOUSE C-Jun-amino-terminal kinase-interacting protein 3 OS=Mus musculus OX=10090 GN=Mapk8ip3 PE=1 SV=1
14	Q9UPT6	0.0	1419	1336	0.591	0.585	JIP3_HUMAN C-Jun-amino-terminal kinase-interacting protein 3 OS=Homo sapiens OX=9606 GN=MAPK8IP3 PE=1 SV=3
15	H0YBS5	5.17e-169	504	250	0.188	0.996	H0YBS5_HUMAN Sperm associated antigen 9 (Fragment) OS=Homo sapiens OX=9606 GN=SPAG9 PE=1 SV=1
16	Q9GQF1	6.31e-129	430	1227	0.251	0.271	JIP3_DROME JNK-interacting protein 3 OS=Drosophila melanogaster OX=7227 GN=syd PE=1 SV=1
17	P34609	2.65e-112	383	1190	0.136	0.150	JIP_CAEEL JNK-interacting protein OS=Caenorhabditis elegans OX=6239 GN=unc-16 PE=1 SV=4
18	Q96PE2	4.97e-31	135	2063	0.081	0.052	ARHGH_HUMAN Rho guanine nucleotide exchange factor 17 OS=Homo sapiens OX=9606 GN=ARHGEF17 PE=1 SV=1
19	M9PHU0	1.16e-23	111	2263	0.055	0.032	M9PHU0_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=CG12432 PE=1 SV=1
20	E1JJN5	1.84e-23	110	1736	0.055	0.042	E1JJN5_DROME Uncharacterized protein, isoform D OS=Drosophila melanogaster OX=7227 GN=CG8557 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03564 DUF1759	2.4e+02	13.1	Protein of unknown function (DUF1759)
2	PF16471 JIP_LZII	6.6e-27	104.8	JNK-interacting protein leucine zipper II
3	PF09744 Jnk-SapK_ap_N	2.3e-49	179.1	JNK_SAPK-associated protein-1
4	PF19056 WD40_2	1.2e-45	167.7	WD40 repeated domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262013

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000298316	0.999	ADP-ribosylation factor 6
2	9606.ENSP00000414982	0.990	Kinesin light chain 1
3	9606.ENSP00000241014	0.934	C-Jun-amino-terminal kinase-interacting protein 1
4	9606.ENSP00000229795	0.933	Mitogen-activated protein kinase 14
5	9606.ENSP00000468348	0.928	Dual specificity mitogen-activated protein kinase kinase 6
6	9606.ENSP00000337425	0.907	Hyaluronidase-3
7	9606.ENSP00000439065	0.900	Uncharacterized protein
8	9606.ENSP00000451828	0.895	RAC-alpha serine/threonine-protein kinase
9	9606.ENSP00000307078	0.844	Kinesin-1 heavy chain
10	9606.ENSP00000267859	0.814	BCL2/adenovirus E1B 19 kDa protein-interacting protein 2
11	9606.ENSP00000378974	0.811	Mitogen-activated protein kinase 8
12	9606.ENSP00000259708	0.784	Kinesin light chain 4
13	9606.ENSP00000333685	0.780	Mitogen-activated protein kinase 11
14	9606.ENSP00000269141	0.772	Cadherin-2
15	9606.ENSP00000345849	0.770	Hyaluronidase PH-20
16	9606.ENSP00000352157	0.770	Mitogen-activated protein kinase 10
17	9606.ENSP00000401853	0.769	Hyaluronidase-2
18	9606.ENSP00000420180	0.743	Coiled-coil domain-containing protein 14
19	9606.ENSP00000360266	0.737	Transcription factor AP-1
20	9606.ENSP00000330572	0.732	C-Jun-amino-terminal kinase-interacting protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030674	1.000	protein-macromolecule adaptor activity
GO:0005515	1.000	protein binding
GO:0019900	0.982	kinase binding
GO:0019894	0.859	kinesin binding
GO:0005078	0.777	MAP-kinase scaffold activity
GO:0019901	0.738	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0045664	0.995	regulation of neuron differentiation
GO:1903859	0.990	regulation of dendrite extension
GO:0051093	0.986	negative regulation of developmental process
GO:0031323	0.984	regulation of cellular metabolic process
GO:0048523	0.983	negative regulation of cellular process
GO:0051174	0.974	regulation of phosphorus metabolic process
GO:0001933	0.942	negative regulation of protein phosphorylation
GO:0045665	0.934	negative regulation of neuron differentiation
GO:0030308	0.928	negative regulation of cell growth
GO:0048640	0.919	negative regulation of developmental growth
GO:0009987	0.622	cellular process
GO:0048518	0.347	positive regulation of biological process
GO:0048522	0.303	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043229	0.971	intracellular organelle
GO:0043227	0.968	membrane-bounded organelle
GO:0043231	0.963	intracellular membrane-bounded organelle
GO:0016020	0.956	membrane
GO:0043232	0.945	intracellular non-membrane-bounded organelle
GO:0005856	0.746	cytoskeleton
GO:0031982	0.688	vesicle
GO:0031090	0.675	organelle membrane
GO:0098588	0.608	bounding membrane of organelle
GO:0005576	0.563	extracellular region
GO:0015630	0.558	microtubule cytoskeleton
GO:0005634	0.494	nucleus
GO:0012505	0.434	endomembrane system
GO:0005615	0.400	extracellular space
GO:0005813	0.381	centrosome
GO:0070013	0.357	intracellular organelle lumen
GO:0031981	0.331	nuclear lumen
GO:0005886	0.309	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]