StarFunc result for job id O60281

User Input

>input (1400 residues)
MADEEAEQERLSCGEGGCVAELQRLGERLQELELQLRESRVPAVEAATDYCQQLCQTLLE
YAEKWKTSEDPLPLLEVYTVAIQSYVKARPYLTSECENVALVLERLALSCVELLLCLPVE
LSDKQWEQFQTLVQVAHEKLMENGSCELHFLATLAQETGVWKNPVLCTILSQEPLDKDKV
NEFLAFEGPILLDMRIKHLIKTNQLSQATALAKLCSDHPEIGIKGSFKQTYLVCLCTSSP
NGKLIEEISEVDCKDALEMICNLESEGDEKSALVLCTAFLSRQLQQGDMYCAWELTLFWS
KLQQRVEPSIQVYLERCRQLSLLTKTVYHIFFLIKVINSETEGAGLATCIELCVKALRLE
STENTEVKISICKTISCLLPDDLEVKRACQLSEFLIEPTVDAYYAVEMLYNQPDQKYDEE
NLPIPNSLRCELLLVLKTQWPFDPEFWDWKTLKRQCLALMGEEASIVSSIDELNDSEVYE
KVVDYQEESKETSMNGLSGGVGANSGLLKDIGDEKQKKREIKQLRERGFISARFRNWQAY
MQYCVLCDKEFLGHRIVRHAQKHYKDGIYSCPICAKNFNSKETFVPHVTLHVKQSSKERL
AAMKPLRRLGRPPKITTTNENQKTNTVAKQEQRPIKKNSLYSTDFIVFNDNDGSDDENDD
KDKSYEPEVIPVQKPVPVNEFNCPVTFCKKGFKYFKNLIAHVKGHKDNEDAKRFLEMQSK
KVICQYCRRHFVSVTHLNDHLQMHCGSKPYICIQMKCKAGFNSYAELLTHRKEHQVFRAK
CMFPKCGRIFSEAYLLYDHEAQHYNTYTCKFTGCGKVYRSQGELEKHLDDHSTPPEKVLP
PEAQLNSSGDSIQPSEVNQNTAENIEKERSMLPSENNIENSLLADRSDAWDKSKAESAVT
KQDQISASELRQANGPLSNGLENPATTPLLQSSEVAVSIKVSLNQGIEDNFGKQENSTVE
GSGEALVTDLHTPVEDTCNDLCHPGFQERKEQDCFNDAHVTQNSLVNSETLKIGDLTPQN
LERQVNNLMTFSVQNQAAFQNNLPTSKFECGDNVKTSSNLYNLPLKTLESIAFVPPQSDL
SNSLGTPSVPPKAPVQKFSCQVEGCTRTYNSSQSIGKHMKTAHPDQYAAFKMQRKSKKGQ
KANNLNTPNNGKFVYFLPSPVNSSNPFFTSQTKANGNPACSAQLQHVSPPIFPAHLASVS
TPLLSSMESVINPNITSQDKNEQGGMLCSQMENLPSTALPAQMEDLTKTVLPLNIDSGSD
PFLPLPAESSSMSLFPSPADSGTNSVFSQLENNTNHYSSQIEGNTNSSFLKGGNGENAVF
PSQVNVANNFSSTNAQQSAPEKVKKDRGRGPNGKERKPKHNKRAKWPAIIRDGKFICSRC
YRAFTNPRSLGGHLSKRSYC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9VWE6	0.094	0.073	1.222E-6	2111	0.121	0.081	Q9VWE6.pdb.gz	ELYS_DROME Protein ELYS homolog OS=Drosophila melanogaster OX=7227 GN=Elys PE=1 SV=2
2	AFDB:A0A1W2PQA1	0.059	0.071	3.759E-6	1069	0.106	0.139	A0A1W2PQA1.pdb.gz	A0A1W2PQA1_HUMAN RE1 silencing transcription factor OS=Homo sapiens OX=9606 GN=REST PE=1 SV=2
3	AFDB:F4J8G7	0.096	0.074	3.925E-6	2138	0.129	0.084	F4J8G7.pdb.gz	VIR_ARATH Protein virilizer homolog OS=Arabidopsis thaliana OX=3702 GN=VIR PE=1 SV=1
4	AFDB:Q13127	0.056	0.067	1.499E-5	1097	0.104	0.132	Q13127.pdb.gz	REST_HUMAN RE1-silencing transcription factor OS=Homo sapiens OX=9606 GN=REST PE=1 SV=3
5	AFDB:D4A0R1	0.052	0.060	2.867E-5	1090	0.091	0.117	D4A0R1.pdb.gz	D4A0R1_RAT Zinc finger protein, multitype 2 OS=Rattus norvegicus OX=10116 GN=Zfpm2 PE=4 SV=4
6	AFDB:B2GM62	0.047	0.052	5.979E-5	1142	0.107	0.131	B2GM62.pdb.gz
7	AFDB:Q18508	0.057	0.045	5.979E-5	1784	0.124	0.097	Q18508.pdb.gz	MEL28_CAEEL Protein mel-28 OS=Caenorhabditis elegans OX=6239 GN=mel-28 PE=1 SV=2
8	AFDB:O54963	0.054	0.065	6.807E-5	1069	0.113	0.148	O54963.pdb.gz	REST_RAT RE1-silencing transcription factor OS=Rattus norvegicus OX=10116 GN=Rest PE=1 SV=1
9	AFDB:F1M2B7	0.039	0.036	8.092E-5	1544	0.104	0.094	F1M2B7.pdb.gz	F1M2B7_RAT GLI family zinc finger 2 OS=Rattus norvegicus OX=10116 GN=Gli2 PE=3 SV=3
10	AFDB:O95996	0.085	0.060	8.450E-5	2303	0.116	0.071	O95996.pdb.gz	APCL_HUMAN Adenomatous polyposis coli protein 2 OS=Homo sapiens OX=9606 GN=APC2 PE=1 SV=1
11	PDB:6xt9D	0.100	0.254	5.729E-4	396	0.041	0.146	6xt9D.pdb.gz
12	PDB:7qe7Y	0.068	0.147	1.617E-3	502	0.048	0.133	7qe7Y.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
13	PDB:7dhgC	0.073	0.177	1.688E-3	470	0.039	0.117	7dhgC.pdb.gz
14	PDB:8a3tJ	0.078	0.165	1.922E-3	509	0.028	0.077	8a3tJ.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
15	PDB:7qe7J	0.105	0.215	2.836E-3	510	0.034	0.094	7qe7J.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
16	PDB:5o9zG	0.086	0.118	3.521E-3	804	0.050	0.087	5o9zG.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
17	PDB:7ntfA	0.071	0.096	4.008E-3	918	0.041	0.063	7ntfA.pdb.gz
18	PDB:7tdzC	0.072	0.120	5.664E-3	653	0.047	0.101	7tdzC.pdb.gz	Structure of cytoplasmic ring of nuclear pore complex by integrative cryo-EM and AlphaFold.
19	PDB:2y4uA	0.085	0.169	6.176E-3	424	0.039	0.130	2y4uA.pdb.gz
20	PDB:7kzpG	0.094	0.159	6.176E-3	577	0.051	0.123	7kzpG.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6G798	0.0	1987	2468	0.691	0.392	A0A8I6G798_RAT Zinc finger protein 292 OS=Rattus norvegicus OX=10116 GN=Zfp292 PE=4 SV=1
2	A2A7F4	0.0	702	1918	0.276	0.201	A2A7F4_MOUSE Rearranged L-myc fusion sequence OS=Mus musculus OX=10090 GN=Rlf PE=1 SV=1
3	D3ZXZ1	0.0	2433	2706	0.851	0.441	D3ZXZ1_RAT Zinc finger protein 292 OS=Rattus norvegicus OX=10116 GN=Zfp292 PE=1 SV=1
4	E9Q532	0.0	636	1808	0.245	0.190	E9Q532_MOUSE Rearranged L-myc fusion sequence OS=Mus musculus OX=10090 GN=Rlf PE=1 SV=1
5	Q13129	0.0	712	1914	0.273	0.200	RLF_HUMAN Zinc finger protein Rlf OS=Homo sapiens OX=9606 GN=RLF PE=1 SV=2
6	Q3V1H6	0.0	568	764	0.215	0.394	Q3V1H6_MOUSE C2H2-type domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Rlf PE=2 SV=1
7	Q59GL0	3.13e-137	462	1608	0.176	0.153	Q59GL0_HUMAN Rearranged L-myc fusion sequence variant (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
8	Q3TR19	6.31e-134	417	344	0.139	0.564	Q3TR19_MOUSE Uncharacterized protein (Fragment) OS=Mus musculus OX=10090 GN=Rlf PE=2 SV=1
9	Q3TAD2	2.13e-78	263	299	0.094	0.441	Q3TAD2_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Rlf PE=2 SV=1
10	Q8TF68	2.02e-13	77.4	577	0.036	0.087	ZN384_HUMAN Zinc finger protein 384 OS=Homo sapiens OX=9606 GN=ZNF384 PE=1 SV=2
11	Q9EQJ4	2.99e-13	76.6	579	0.036	0.086	ZN384_RAT Zinc finger protein 384 OS=Rattus norvegicus OX=10116 GN=Znf384 PE=1 SV=1
12	Q60821	5.23e-13	76.3	794	0.059	0.105	ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus OX=10090 GN=Zbtb17 PE=1 SV=2
13	Q9VDZ3	6.97e-13	75.5	535	0.046	0.120	SQZ_DROME Zinc finger protein squeeze OS=Drosophila melanogaster OX=7227 GN=sqz PE=1 SV=2
14	A6NJL1	2.51e-12	73.6	495	0.034	0.097	ZSA5B_HUMAN Zinc finger and SCAN domain-containing protein 5B OS=Homo sapiens OX=9606 GN=ZSCAN5B PE=1 SV=1
15	Q6NX45	3.66e-12	72.8	483	0.051	0.147	ZN774_HUMAN Zinc finger protein 774 OS=Homo sapiens OX=9606 GN=ZNF774 PE=1 SV=2
16	G5EGB2	9.31e-12	71.6	459	0.028	0.085	LIN29_CAEEL Zinc finger transcription factor lin-29 OS=Caenorhabditis elegans OX=6239 GN=lin-29 PE=1 SV=1
17	P98168	1.02e-11	72.0	799	0.051	0.090	ZXDA_HUMAN Zinc finger X-linked protein ZXDA OS=Homo sapiens OX=9606 GN=ZXDA PE=1 SV=2
18	Q9VI93	1.04e-11	72.4	946	0.034	0.050	RN_DROME Zinc finger protein rotund OS=Drosophila melanogaster OX=7227 GN=rn PE=1 SV=2
19	Q13105	1.12e-11	72.0	803	0.061	0.106	ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ZBTB17 PE=1 SV=3
20	G3V9G6	1.17e-11	72.0	740	0.053	0.100	G3V9G6_RAT Zinc finger protein 111 OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=4 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16159 FOXP-CC	2.9	19.8	FOXP coiled-coil domain
2	PF00096 zf-C2H2	2.5e-08	45.0	Zinc finger, C2H2 type
3	PF13894 zf-C2H2_4	2.3e-11	54.5	C2H2-type zinc finger
4	PF13912 zf-C2H2_6	2e-05	35.7	C2H2-type zinc finger
5	PF15909 zf-C2H2_8	55	15.5	C2H2-type zinc ribbon
6	PF12171 zf-C2H2_jaz	3.7	19.2	Zinc-finger double-stranded RNA-binding
7	PF16278 zf-C2HE	1.2e+02	14.6	C2HE / C2H2 / C2HC zinc-binding finger
8	PF13465 zf-H2C2_2	69	15.3	Zinc-finger double domain
9	PF11682 zinc_ribbon_11	30	16.1	Probable zinc-ribbon

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358590

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000373575	0.770	Uncharacterized protein C6orf163
2	9606.ENSP00000257789	0.705	Origin recognition complex subunit 3
3	9606.ENSP00000262244	0.705	MOB kinase activator 3B
4	9606.ENSP00000394484	0.704	Serine/threonine-protein kinase DCLK3
5	9606.ENSP00000257787	0.681	Akirin-2
6	9606.ENSP00000358497	0.677	mRNA-capping enzyme
7	9606.ENSP00000358549	0.672	Probable arginine--tRNA ligase, mitochondrial
8	9606.ENSP00000484135	0.668	Colorectal cancer associated 2
9	9606.ENSP00000412673	0.663	Gamma-aminobutyric acid receptor subunit rho-1
10	9606.ENSP00000307684	0.656	Transcriptional adapter 3
11	9606.ENSP00000414721	0.648	WW domain binding protein 1 like
12	9606.ENSP00000435355	0.628	Gap junction beta-7 protein
13	9606.ENSP00000392678	0.623	Functions as signal transducer for MSTN during skeletal muscle regeneration and myogenesis. May regulate chemotaxis of both macrophages and myoblasts by reorganising actin cytoskeleton, leading to more efficient lamellipodia formation via a PI3 kinase dependent pathway
14	9606.ENSP00000358635	0.618	Heterogeneous nuclear ribonucleoprotein Q
15	9606.ENSP00000349575	0.553	MOB kinase activator 3A
16	9606.ENSP00000485378	0.552	Ribonuclease P protein subunit p21
17	9606.ENSP00000386657	0.540	Protein FAM183BP
18	9606.ENSP00000322845	0.515	Zinc finger MYM-type protein 3
19	9606.ENSP00000418751	0.506	BTB/POZ domain-containing protein 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140110	1.000	transcription regulator activity
GO:0005515	1.000	protein binding
GO:0001216	0.992	DNA-binding transcription activator activity
GO:0001228	0.980	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:1901363	0.972	heterocyclic compound binding
GO:0097159	0.972	organic cyclic compound binding
GO:0003676	0.943	nucleic acid binding
GO:0003677	0.814	DNA binding
GO:0043565	0.315	sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0019219	0.982	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.955	regulation of macromolecule biosynthetic process
GO:0031326	0.955	regulation of cellular biosynthetic process
GO:0051252	0.955	regulation of RNA metabolic process
GO:2001141	0.952	regulation of RNA biosynthetic process
GO:0010468	0.930	regulation of gene expression
GO:0048518	0.908	positive regulation of biological process
GO:0006355	0.900	regulation of DNA-templated transcription
GO:0048522	0.898	positive regulation of cellular process
GO:0010604	0.847	positive regulation of macromolecule metabolic process
GO:0051173	0.834	positive regulation of nitrogen compound metabolic process
GO:0010557	0.760	positive regulation of macromolecule biosynthetic process
GO:0045893	0.751	positive regulation of DNA-templated transcription
GO:0006357	0.554	regulation of transcription by RNA polymerase II
GO:0009987	0.547	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]