StarFunc result for job id O60285

User Input

>input (661 residues)
MEGAAAPVAGDRPDLGLGAPGSPREAVAGATAALEPRKPHGVKRHHHKHNLKHRYELQET
LGKGTYGKVKRATERFSGRVVAIKSIRKDKIKDEQDMVHIRREIEIMSSLNHPHIISIYE
VFENKDKIVIIMEYASKGELYDYISERRRLSERETRHFFRQIVSAVHYCHKNGVVHRDLK
LENILLDDNCNIKIADFGLSNLYQKDKFLQTFCGSPLYASPEIVNGRPYRGPEVDSWALG
VLLYTLVYGTMPFDGFDHKNLIRQISSGEYREPTQPSDARGLIRWMLMVNPDRRATIEDI
ANHWWVNWGYKSSVCDCDALHDSESPLLARIIDWHHRSTGLQADTEAKMKGLAKPTTSEV
MLERQRSLKKSKKENDFAQSGQDAVPESPSKLSSKRPKGILKKRSNSEHRSHSTGFIEGV
VGPALPSTFKMEQDLCRTGVLLPSSPEAEVPGKLSPKQSATMPKKGILKKTQQRESGYYS
SPERSESSELLDSNDVMGSSIPSPSPPDPARVTSHSLSCRRKGILKHSSKYSAGTMDPAL
VSPEMPTLESLSEPGVPAEGLSRSYSRPSSVISDDSVLSSDSFDLLDLQENRPARQRIRS
CVSAENFLQIQDFEGLQNRPRPQYLKRYRNRLADSSFSLLTDMDDVTQVYKQALEICSKL
N

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RBL3	0.462	0.462	5.146E-93	661	1.000	1.000	A0A024RBL3.pdb.gz
2	AFDB:Q66HE5	0.451	0.472	2.547E-59	630	0.557	0.584	Q66HE5.pdb.gz	NUAK2_RAT NUAK family SNF1-like kinase 2 OS=Rattus norvegicus OX=10116 GN=Nuak2 PE=1 SV=1
3	AFDB:H2KYA5	0.401	0.150	1.147E-37	1793	0.346	0.128	H2KYA5.pdb.gz	H2KYA5_CAEEL Protein kinase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-82 PE=1 SV=1
4	AFDB:B9DFC1	0.387	0.498	6.692E-34	512	0.212	0.273	B9DFC1.pdb.gz	B9DFC1_ARATH non-specific serine/threonine protein kinase OS=Arabidopsis thaliana OX=3702 GN=At3g01090 PE=1 SV=1
5	AFDB:P27448	0.395	0.348	1.327E-33	753	0.287	0.252	P27448.pdb.gz	MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens OX=9606 GN=MARK3 PE=1 SV=5
6	AFDB:Q7KZI7	0.397	0.333	1.667E-33	788	0.290	0.244	Q7KZI7.pdb.gz	MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens OX=9606 GN=MARK2 PE=1 SV=2
7	AFDB:A1ZBL5	0.397	0.278	2.218E-33	951	0.259	0.180	A1ZBL5.pdb.gz	A1ZBL5_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=2
8	AFDB:A1ZBL7	0.394	0.263	4.929E-33	993	0.269	0.179	A1ZBL7.pdb.gz	A1ZBL7_DROME Par-1, isoform H OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=1
9	AFDB:P92958	0.399	0.513	5.849E-33	512	0.210	0.271	P92958.pdb.gz	KIN11_ARATH SNF1-related protein kinase catalytic subunit alpha KIN11 OS=Arabidopsis thaliana OX=3702 GN=KIN11 PE=1 SV=1
10	AFDB:Q14680	0.398	0.404	2.300E-32	651	0.238	0.241	Q14680.pdb.gz	MELK_HUMAN Maternal embryonic leucine zipper kinase OS=Homo sapiens OX=9606 GN=MELK PE=1 SV=3
11	PDB:4zhxA	0.386	0.616	6.053E-31	409	0.195	0.315	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
12	PDB:6b1uA	0.387	0.573	8.051E-31	442	0.198	0.296	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
13	PDB:7myjC	0.387	0.545	1.200E-30	465	0.195	0.277	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
14	PDB:4rerA	0.391	0.558	2.380E-30	459	0.203	0.292	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
15	PDB:5ufuA	0.375	0.665	1.856E-29	369	0.185	0.331	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
16	PDB:4rewA	0.374	0.596	7.725E-29	411	0.192	0.309	4rewA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
17	PDB:5u6yA	0.367	0.523	6.477E-26	459	0.162	0.233	5u6yA.pdb.gz
18	PDB:4c0tA	0.362	0.802	4.169E-24	291	0.141	0.320	4c0tA.pdb.gz
19	PDB:4d28C	0.352	0.800	4.577E-23	279	0.163	0.387	4d28C.pdb.gz
20	PDB:5x3fB	0.364	0.677	5.130E-23	349	0.124	0.235	5x3fB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B4E0Y5	0.0	648	672	0.560	0.551	B4E0Y5_HUMAN cDNA FLJ56013, highly similar to NUAK family SNF1-like kinase 2 OS=Homo sapiens OX=9606 PE=2 SV=1
2	O60285	0.0	1368	661	1.000	1.000	NUAK1_HUMAN NUAK family SNF1-like kinase 1 OS=Homo sapiens OX=9606 GN=NUAK1 PE=1 SV=1
3	Q66HE5	0.0	644	630	0.554	0.581	NUAK2_RAT NUAK family SNF1-like kinase 2 OS=Rattus norvegicus OX=10116 GN=Nuak2 PE=1 SV=1
4	Q9H093	0.0	647	628	0.560	0.589	NUAK2_HUMAN NUAK family SNF1-like kinase 2 OS=Homo sapiens OX=9606 GN=NUAK2 PE=1 SV=1
5	H2KYA7	1.20e-108	360	1483	0.253	0.113	H2KYA7_CAEEL Protein kinase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-82 PE=1 SV=1
6	D1MN54	2.34e-108	360	1554	0.253	0.107	D1MN54_CAEEL Protein kinase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-82 PE=1 SV=1
7	H2KYA8	2.35e-108	360	1480	0.253	0.113	H2KYA8_CAEEL Protein kinase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-82 PE=1 SV=1
8	H2KYA6	2.40e-108	360	1490	0.253	0.112	H2KYA6_CAEEL Protein kinase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-82 PE=1 SV=1
9	D1MN51	2.56e-108	360	1578	0.253	0.106	D1MN51_CAEEL Protein kinase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-82 PE=1 SV=1
10	H2KYA9	2.63e-108	360	1544	0.253	0.108	H2KYA9_CAEEL Protein kinase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-82 PE=1 SV=1
11	H2KYA5	4.11e-108	361	1793	0.253	0.093	H2KYA5_CAEEL Protein kinase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-82 PE=1 SV=1
12	P92958	4.01e-82	270	512	0.201	0.260	KIN11_ARATH SNF1-related protein kinase catalytic subunit alpha KIN11 OS=Arabidopsis thaliana OX=3702 GN=KIN11 PE=1 SV=1
13	Q38997	4.74e-82	270	512	0.198	0.256	KIN10_ARATH SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Arabidopsis thaliana OX=3702 GN=KIN10 PE=1 SV=3
14	A0A8I6A623	1.20e-81	274	688	0.192	0.185	A0A8I6A623_RAT Microtubule affinity regulating kinase 4 OS=Rattus norvegicus OX=10116 GN=Mark4 PE=4 SV=1
15	B9DFC1	2.22e-81	268	512	0.197	0.254	B9DFC1_ARATH non-specific serine/threonine protein kinase OS=Arabidopsis thaliana OX=3702 GN=At3g01090 PE=1 SV=1
16	Q96L34	1.06e-80	273	752	0.192	0.169	MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens OX=9606 GN=MARK4 PE=1 SV=1
17	D4A6T9	1.40e-80	272	752	0.192	0.169	D4A6T9_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Mark4 PE=3 SV=1
18	Q8CIP4	1.45e-80	272	752	0.192	0.169	MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus OX=10090 GN=Mark4 PE=1 SV=1
19	A0A0G2JTD8	2.08e-80	272	744	0.192	0.171	A0A0G2JTD8_RAT Microtubule affinity regulating kinase 4 OS=Rattus norvegicus OX=10116 GN=Mark4 PE=4 SV=2
20	O08679	7.38e-78	265	722	0.186	0.170	MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus OX=10116 GN=Mark2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	2.7	18.6	ABC1 atypical kinase-like domain
2	PF19250 DUF5898	1.3	20.3	Family of unknown function (DUF5898)
3	PF13095 FTA2	4.6e+02	11.9	Kinetochore Sim4 complex subunit FTA2
4	PF12330 Haspin_kinase	0.32	21.5	Haspin like kinase domain
5	PF06293 Kdo	0.12	23.3	Lipopolysaccharide kinase (Kdo/WaaP) family
6	PF14531 Kinase-like	0.036	25.0	Kinase-like
7	PF00069 Pkinase	1.1e-73	259.4	Protein kinase domain
8	PF07714 PK_Tyr_Ser-Thr	5.3e-41	152.2	Protein tyrosine and serine/threonine kinase
9	PF01163 RIO1	0.11	23.7	RIO1 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261402

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000324856	0.895	Serine/threonine-protein kinase STK11
2	9606.ENSP00000316357	0.838	Probable ubiquitin carboxyl-terminal hydrolase FAF-X
3	9606.ENSP00000389168	0.777	Protein phosphatase 1 regulatory subunit 12A
4	9606.ENSP00000359206	0.771	F-box/WD repeat-containing protein 1A
5	9606.ENSP00000269305	0.762	Cellular tumor antigen p53
6	9606.ENSP00000371297	0.659	Syntaphilin
7	9606.ENSP00000265094	0.636	F-box/WD repeat-containing protein 11
8	9606.ENSP00000280758	0.621	Ankyrin repeat and BTB/POZ domain-containing protein BTBD11
9	9606.ENSP00000377040	0.608	Alpha-aminoadipic semialdehyde synthase, mitochondrial
10	9606.ENSP00000373539	0.605	Stabilin-2
11	9606.ENSP00000261520	0.600	Little elongation complex subunit 2
12	9606.ENSP00000378769	0.578	Serine/threonine-protein phosphatase PP1-beta catalytic subunit
13	9606.ENSP00000238558	0.515	Homeobox protein goosecoid
14	9606.ENSP00000314724	0.504	Liprin-beta-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004674	0.998	protein serine/threonine kinase activity
GO:0002039	0.997	p53 binding
GO:1901363	0.700	heterocyclic compound binding
GO:0097159	0.695	organic cyclic compound binding
GO:0046872	0.569	metal ion binding
GO:0000287	0.300	magnesium ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:0044237	0.998	cellular metabolic process
GO:0006807	0.997	nitrogen compound metabolic process
GO:0043170	0.996	macromolecule metabolic process
GO:0019538	0.991	protein metabolic process
GO:0050794	0.990	regulation of cellular process
GO:0036211	0.982	protein modification process
GO:0006793	0.980	phosphorus metabolic process
GO:0006796	0.974	phosphate-containing compound metabolic process
GO:0006468	0.959	protein phosphorylation
GO:0050896	0.732	response to stimulus
GO:0019222	0.729	regulation of metabolic process
GO:0060255	0.714	regulation of macromolecule metabolic process
GO:0080090	0.609	regulation of primary metabolic process
GO:0051171	0.609	regulation of nitrogen compound metabolic process
GO:0048519	0.582	negative regulation of biological process
GO:0051716	0.565	cellular response to stimulus
GO:0031323	0.562	regulation of cellular metabolic process
GO:0048518	0.525	positive regulation of biological process
GO:0048523	0.471	negative regulation of cellular process
GO:0065009	0.461	regulation of molecular function
GO:0051246	0.461	regulation of protein metabolic process
GO:0007154	0.424	cell communication
GO:0048522	0.399	positive regulation of cellular process
GO:0009893	0.373	positive regulation of metabolic process
GO:0050790	0.359	regulation of catalytic activity
GO:0010604	0.350	positive regulation of macromolecule metabolic process
GO:0048583	0.330	regulation of response to stimulus
GO:0010646	0.326	regulation of cell communication
GO:0023051	0.325	regulation of signaling
GO:0009966	0.313	regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0031981	1.000	nuclear lumen
GO:0005654	0.994	nucleoplasm
GO:0005730	0.992	nucleolus
GO:0005737	0.989	cytoplasm
GO:0005856	0.972	cytoskeleton
GO:0001650	0.936	fibrillar center
GO:0015630	0.898	microtubule cytoskeleton
GO:0005829	0.683	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.998	Phosphotransferases with an alcohol group as acceptor.

[back to server]