StarFunc result for job id O60287

User Input

>input (2271 residues)
MGVPKRKASGGQDGAASSAGAAKRARKEELTGVRFKAQLKDPQGPGPGLEAFVSAAKKLP
REDVYDVVEGYIKISVECVEIFQLLSGEKRPESETMLIFQVFEAILLRTASDLSHFHVVG
TNIVKKLMNNHMKLICESLYASGYRLARACLSLMTAMVTQGPEAARDVCSHFDLNKKTLY
TLVTKRDSKGVYDVRQAYVQFALSFLIAGDDSTIVQVLEVKEFIPCIFSSGIKEDRISTI
NILLSTLKTKVVHNKNITKTQKVRFFTGQLLNHIASLYNWNGITDVNPENVKVSAEEAGK
TMVRELVHNFLMDLCCSLKHGINFYDASLGTFGRGGNLTLLHFLLGLKTAADDDLVADLV
VNILKVCPDLLNKYFKEVTFSFIPRAKSTWLNNIKLLNKIYEAQPEISRAFQTREFIPLP
RLLAMVMVTTVPLVCNKSMFTQALNLDSTSVRHTALSLISVILKRALKTVDHCLNKEVWQ
ESGVYTAVMMEEFVQLFREALSKILPDLNTVVWVWQSLKKQETKQDDKKGQKRSDGPPAA
CDAHQCDDAETILLKAVLLQVICLYQKVVPHVVMQYNFDFSKLLKGVISEQGLREEVPPI
LQHHMLKVALELPASKFLWLKAQEGPDAEIIGGERSVFYLLMKMFVTSSHLQLKSLTKLL
IMKILRDTGVFEHTWKELELWLEHLENTMEEDKETVIQFLERILLTLVANPYSYTDKASD
FVQEASMLQATMTKQEADDMSIPISHIDDVLDMVDVLVEGSEGLDEEIGFTLSEDMILLT
FPFSAVVPAALEARNKLLLGTGNEAAENVVTYLTAVLTDLLHTQRDPLALCLLLQAYDKL
EPPCLVPCCQQLSRFNRYYSLWIPEQAREAWLLQAQGSPSPPALPLASSFTALLQAAYES
QALRDEHIQVQLQATMPHLSMQQVLLAAKQVLLYLRSTVENFGQLGRSVGPPLLQLFLDL
LRRLVVHCEQLDAQNQQRCEAARAEADLFLDMESVASLELANDQTLEEVLVAILRHPTLE
GWFLALEQQALPPHTLSPVLVKLLATHFSAGVLQLLAASAPILQNIGQLGLLARYSEAIT
QSVLKELQNRRAGPATSPPKTPPQLEALQELHPYMEGAQLREVTLALLSLPETHLVTQQP
TKSPGKERHLNALGKTLVQLLTCSPQDQLQSGELLWSSEYVRGLGALLPTLAVDELDTVL
LHTLQRDPVLAPAVGADLLDYCLARRTQAALSIAALLLQESCTHLLWFEQWCLQAGPGLG
LQGDLDDFLPLIHVYLQCRTRSHFTRPAGVSSAVIPVLRKTLWRQLQSRLLSTDSPPASG
LYQEILAQLVPFARAKDLSVLMDRLPSLLHTPSSHKRWIVADSISAALEGSAEELCAWRR
TLLESCVKWLIVSFSGGQQDDDNTQNQEKEMLLRLNALLHALNEVDPGDWQKFVKKGLKF
RYQDHTFLKMLLTAVQLLYSPESSVRTKLIQLPVVYVMLMQHSLFLPTLLTSDGEESPDS
QVKEALVDLMLTVVEMCPSVCESSHFAVLLGAYGATLSVLDQKILLLLRAYEQNKLSLIN
FRVLLWGPAAVEHHKTCRSLGRSLWQQPSVGDILRLLDRDRMMQTILHFPQNRRLLPPED
TQELIFKDKSRVDLDGLYDPCFLLQLFSELTRPEFVVDCRKFLDSNALGLTVTALSSYDP
QMRAIAYHVLAAYYSHLEGARFQEQSQLLYLLDVVRNGIRTQDMRLTFTLALFIAKAALQ
ILKPEEHMYLKVSNFLLSHEYLNMDKVPGFYQFFYSSDFEQKTEQKWVFGVLRQGIRDKQ
CYELCARRGIFHIILSFFHSPLCDEAAQNWILEILQNAAQVARSAYEIIRDYSLLTWILH
ILESKFLETPLLSNVISLLHTLWVTNLGDKAVEWESQRLCQPSSQEPAKRLALHLVNEFL
YVLIVLMKHLRPTLAPVQLTNFFGTLDSVLRYRATVIQAFRDMNRFTVNETVLSTKDVLV
LLHKWSLIERDLKLQEDLRAAIEKAQARELMKMLKDKNKPVMPARAKGPRGRKRRPGEAE
EMADPELMASTLETCKGLLRSILTYWRPVIPGPDPTQEPVDSASPESDAPGPVYAAASLA
VSWVLRSVAEHPLSRAEAAGLIGWLKSHILPHPVVVADLLKDSAVRSSIFRLYSRLCGAE
GLAGPVQEVACLFNTVMLQLVAAQGRAGSPFHPAMEALSLSSLSEKDEATQASAAFLVSL
YIKDIWLGAQRPDTLLTHVRMVCEAADDAPSSEEEAIVVLCKDAASAASDA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8QID6	0.801	0.804	0.000	2263	0.430	0.432	A0A2R8QID6.pdb.gz
2	AFDB:O60287	1.000	1.000	0.000	2271	1.000	1.000	O60287.pdb.gz	NPA1P_HUMAN Nucleolar pre-ribosomal-associated protein 1 OS=Homo sapiens OX=9606 GN=URB1 PE=1 SV=4
3	AFDB:F4IBR2	0.359	0.343	1.583E-37	2401	0.160	0.152	F4IBR2.pdb.gz	F4IBR2_ARATH Nucleolar pre-ribosomal-associated protein OS=Arabidopsis thaliana OX=3702 GN=IDAP1 PE=4 SV=2
4	AFDB:O74415	0.354	0.454	1.788E-31	1568	0.119	0.173	O74415.pdb.gz	YJL2_SCHPO Uncharacterized protein C14G10.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC14G10.02 PE=4 SV=1
5	AFDB:P34241	0.317	0.399	1.481E-29	1764	0.120	0.154	P34241.pdb.gz	URB1_YEAST Nucleolar pre-ribosomal-associated protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=URB1 PE=1 SV=2
6	AFDB:F4I718	0.144	0.151	4.100E-11	2136	0.113	0.120	F4I718.pdb.gz	CSI3_ARATH Protein CELLULOSE SYNTHASE INTERACTIVE 3 OS=Arabidopsis thaliana OX=3702 GN=CSI3 PE=1 SV=1
7	AFDB:Q9W350	0.104	0.120	9.775E-11	1742	0.125	0.163	Q9W350.pdb.gz	Q9W350_DROME C11.1, isoform A OS=Drosophila melanogaster OX=7227 GN=c11.1 PE=1 SV=2
8	AFDB:F4JN05	0.081	0.098	3.113E-10	1706	0.106	0.141	F4JN05.pdb.gz	BIG4_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 4 OS=Arabidopsis thaliana OX=3702 GN=BIG4 PE=3 SV=1
9	PDB:7mq8SP	0.097	0.104	3.117E-10	1993	0.124	0.141	7mq8SP.pdb.gz	Nucleolar maturation of the human small subunit processome.
10	PDB:7sukSP	0.101	0.102	5.365E-10	2234	0.118	0.120	7sukSP.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
11	PDB:7su3A	0.100	0.078	6.666E-10	3802	0.140	0.084	7su3A.pdb.gz	Autophosphorylation transforms DNA-PK from protecting to processing DNA ends.
12	PDB:7sglA	0.105	0.079	7.167E-10	3852	0.139	0.082	7sglA.pdb.gz	Autophosphorylation transforms DNA-PK from protecting to processing DNA ends.
13	PDB:7mqaSP	0.125	0.118	7.431E-10	2485	0.125	0.114	7mqaSP.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	AFDB:Q9P2D3	0.129	0.136	1.232E-9	2071	0.135	0.148	Q9P2D3.pdb.gz	HTR5B_HUMAN HEAT repeat-containing protein 5B OS=Homo sapiens OX=9606 GN=HEATR5B PE=1 SV=2
15	AFDB:Q385P3	0.232	0.318	1.278E-9	1584	0.097	0.139	Q385P3.pdb.gz	Q385P3_TRYB2 Nucleolar pre-ribosomal-associated protein 1 C-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2920 PE=4 SV=1
16	PDB:7sudA	0.118	0.087	1.648E-9	3740	0.148	0.090	7sudA.pdb.gz	Autophosphorylation transforms DNA-PK from protecting to processing DNA ends.
17	PDB:6x9oA	0.116	0.112	2.367E-9	2425	0.137	0.129	6x9oA.pdb.gz
18	PDB:7tyrA	0.113	0.082	2.545E-9	3905	0.150	0.087	7tyrA.pdb.gz
19	PDB:7otmA	0.106	0.083	2.638E-9	3656	0.136	0.085	7otmA.pdb.gz	Structural insights into inhibitor regulation of the DNA repair protein DNA-PKcs.
20	PDB:7ajuUT	0.153	0.152	3.789E-9	2313	0.134	0.131	7ajuUT.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4ILM9	0.0	1753	2234	0.432	0.440	A0A0R4ILM9_DANRE Nucleolar pre-ribosomal-associated protein 1 OS=Danio rerio OX=7955 GN=mp:zf637-1-000544 PE=1 SV=1
2	O60287	0.0	4651	2271	1.000	1.000	NPA1P_HUMAN Nucleolar pre-ribosomal-associated protein 1 OS=Homo sapiens OX=9606 GN=URB1 PE=1 SV=4
3	F4IBR2	2.23e-22	108	2401	0.041	0.038	F4IBR2_ARATH Nucleolar pre-ribosomal-associated protein OS=Arabidopsis thaliana OX=3702 GN=IDAP1 PE=4 SV=2
4	O74415	3.78e-09	65.1	1568	0.022	0.031	YJL2_SCHPO Uncharacterized protein C14G10.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC14G10.02 PE=4 SV=1
5	P34241	1.4	36.6	1764	0.039	0.050	URB1_YEAST Nucleolar pre-ribosomal-associated protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=URB1 PE=1 SV=2
6	P83784	6.3	34.3	648	0.010	0.034	HSP77_CANAL Heat shock protein SSC1, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SSC1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16201 NopRA1	8.2e-50	180.7	Nucleolar pre-ribosomal-associated protein 1
2	PF11707 Npa1	3.1e-80	281.7	Ribosome 60S biogenesis N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000372199

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358812	0.953	Protein RRP5 homolog
2	9606.ENSP00000258243	0.949	URB2 ribosome biogenesis 2 homolog
3	9606.ENSP00000355541	0.922	HEAT repeat-containing protein 1
4	9606.ENSP00000481495	0.919	ATP-dependent RNA helicase DDX24
5	9606.ENSP00000258772	0.915	Probable ATP-dependent RNA helicase DDX56
6	9606.ENSP00000257829	0.906	RNA cytidine acetyltransferase
7	9606.ENSP00000444136	0.903	DNA-directed RNA polymerase I subunit RPA2
8	9606.ENSP00000423067	0.899	WD repeat-containing protein 36
9	9606.ENSP00000446184	0.892	RRP12-like protein
10	9606.ENSP00000234170	0.891	CCAAT/enhancer-binding protein zeta
11	9606.ENSP00000371858	0.891	Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase
12	9606.ENSP00000380495	0.890	ATP-dependent RNA helicase DDX51
13	9606.ENSP00000455106	0.889	Ribosome biogenesis protein BOP1
14	9606.ENSP00000253237	0.888	Glutamate-rich WD repeat-containing protein 1
15	9606.ENSP00000261637	0.888	Small subunit processome component 20 homolog
16	9606.ENSP00000317992	0.887	Nucleolar complex protein 2 homolog
17	9606.ENSP00000314348	0.876	Probable ATP-dependent RNA helicase DDX10
18	9606.ENSP00000483495	0.876	Probable ATP-dependent RNA helicase DDX27
19	9606.ENSP00000311135	0.875	Probable ATP-dependent RNA helicase DHX37
20	9606.ENSP00000223073	0.874	RNA-binding protein 28

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0005515	0.881	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.990	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0009987	0.792	cellular process
GO:0048518	0.383	positive regulation of biological process
GO:0019222	0.370	regulation of metabolic process
GO:0071704	0.355	organic substance metabolic process
GO:0060255	0.348	regulation of macromolecule metabolic process
GO:0032502	0.341	developmental process
GO:0051171	0.338	regulation of nitrogen compound metabolic process
GO:0080090	0.337	regulation of primary metabolic process
GO:0032501	0.331	multicellular organismal process
GO:0031323	0.325	regulation of cellular metabolic process
GO:0044238	0.311	primary metabolic process
GO:0044237	0.306	cellular metabolic process
GO:0006807	0.302	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0001650	0.997	fibrillar center
GO:0005654	0.965	nucleoplasm
GO:0016020	0.499	membrane
GO:0032991	0.416	protein-containing complex
GO:0005737	0.407	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]