StarFunc result for job id O60292

User Input

>input (1781 residues)
MTTYRAIPSDGVDLAASCGARVGDVLPGPHTGDYAPLGFWAQNGSMSQPLGESPATATAT
ATATTRPSPTTPAMPKMGVRARVADWPPKREALREHSNPSPSQDTDGTKATKMAHSMRSI
QNGQPPTSTPASSGSKAFHRLSRRRSKDVEFQDGWPRSPGRAFLPLRHRSSSEITLSECD
AEDAGEPRGARHTGALPLFREYGSTSSIDVQGMPEQSFFDILNEFRSEQPDARGCQALTE
LLRADPGPHLMGGGGGAKGDSHNGQPAKDSLLPLQPTKEKEKARKKPARGLGGGDTVDSS
IFRKLRSSKPEGEAGRSPGEADEGRSPPEASRPWVCQKSFAHFDVQSMLFDLNEAAANRV
SVSQRRNTTTGASAASAASAMASLTASRAHSLGGLDPAFTSTEDLNCKENLEQDLGDDNS
NDLLLSCPHFRNEIGGECERNVSFSRASVGSPSSGEGHLAEPALSAYRTNASISVLEVPK
EQQRTQSRPRQYSIEHVDLGARYYQDYFVGKEHANYFGVDEKLGPVAVSIKREKLEDHKE
HGPQYQYRIIFRTRELITLRGSILEDATPTATKHGTGRGLPLKDALEYVIPELNIHCLRL
ALNTPKVTEQLLKLDEQGLCRKHKVGILYCKAGQSSEEEMYNNEEAGPAFEEFLSLIGEK
VCLKGFTKYAAQLDVKTDSTGTHSLYTMYQDYEIMFHVSTLLPYTPNNRQQLLRKRHIGN
DIVTIIFQEPGALPFTPKNIRSHFQHVFIIVRVHNPCTDNVCYSMAVTRSKDAPPFGPPI
PSGTTFRKSDVFRDFLLAKVINAENAAHKSDKFHTMATRTRQEYLKDLAENCVSNTPIDS
TGKFNLISLTSKKKEKTKARAGAEQHSAGAIAWRVVAQDYAQGVEIDCILGISNEFVVLL
DLRTKEVVFNCYCGDVIGWTPDSSTLKIFYGRGDHIFLQATEGSVEDIREIVQRLKVMTS
GWETVDMTLRRNGLGQLGFHVKYDGTVAEVEDYGFAWQAGLRQGSRLVEICKVAVVTLTH
DQMIDLLRTSVTVKVVIIPPFEDGTPRRGWPETYDMNTSEPKTEQESITPGGRPPYRSNA
PWQWSGPASHNSLPASKWATPTTPGHAQSLSRPLKQTPIVPFRESQPLHSKRPVSFPETP
YTVSPAGADRVPPYRQPSGSFSTPGSATYVRYKPSPERYTAAPHPLLSLDPHFSHDGTSS
GDSSSGGLTSQESTMERQKPEPLWHVPAQARLSAIAGSSGNKHPSRQDAAGKDSPNRHSK
GEPQYSSHSSSNTLSSNASSSHSDDRWFDPLDPLEPEQDPLSKGGSSDSGIDTTLYTSSP
SCMSLAKAPRPAKPHKPPGSMGLCGGGREAAGRSHHADRRREVSPAPAVAGQSKGYRPKL
YSSGSSTPTGLAGGSRDPPRQPSDMGSRVGYPAQVYKTASAETPRPSQLAQPSPFQLSAS
VPKSFFSKQPVRNKHPTGWKRTEEPPPRPLPFSDPKKQVDTNTKNVFGQPRLRASLRDLR
SPRKNYKSTIEDDLKKLIIMDNLGPEQERDTGQSPQKGLQRTLSDESLCSGRREPSFASP
AGLEPGLPSDVLFTSTCAFPSSTLPARRQHQHPHPPVGPGATPAAGSGFPEKKSTISASE
LSLADGRDRPLRRLDPGLMPLPDTAAGLEWSSLVNAAKAYEVQRAVSLFSLNDPALSPDI
PPAHSPVHSHLSLERGPPTPRTTPTMSEEPPLDLTGKVYQLEVMLKQLHTDLQKEKQDKV
VLQSEVASLRQNNQRLQEESQAASEQLRKFAEIFCREKKEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8RNK4	0.473	0.489	0.000	1718	0.556	0.576	A0A2R8RNK4.pdb.gz
2	AFDB:O35412	0.436	0.426	0.000	1822	0.482	0.471	O35412.pdb.gz	SI1L1_RAT Signal-induced proliferation-associated 1-like protein 1 OS=Rattus norvegicus OX=10116 GN=Sipa1l1 PE=1 SV=1
3	AFDB:O43166	0.437	0.432	0.000	1804	0.485	0.479	O43166.pdb.gz	SI1L1_HUMAN Signal-induced proliferation-associated 1-like protein 1 OS=Homo sapiens OX=9606 GN=SIPA1L1 PE=1 SV=4
4	AFDB:O60292	1.000	1.000	0.000	1781	1.000	1.000	O60292.pdb.gz	SI1L3_HUMAN Signal-induced proliferation-associated 1-like protein 3 OS=Homo sapiens OX=9606 GN=SIPA1L3 PE=1 SV=3
5	AFDB:Q8C0T5	0.436	0.436	0.000	1782	0.483	0.483	Q8C0T5.pdb.gz	SI1L1_MOUSE Signal-induced proliferation-associated 1-like protein 1 OS=Mus musculus OX=10090 GN=Sipa1l1 PE=1 SV=2
6	AFDB:Q9P2F8	0.419	0.433	0.000	1722	0.455	0.471	Q9P2F8.pdb.gz	SI1L2_HUMAN Signal-induced proliferation-associated 1-like protein 2 OS=Homo sapiens OX=9606 GN=SIPA1L2 PE=1 SV=2
7	PDB:7dl2B	0.111	0.175	1.691E-11	1042	0.036	0.062	7dl2B.pdb.gz
8	PDB:7dl2A	0.107	0.154	1.058E-10	1127	0.030	0.048	7dl2A.pdb.gz
9	AFDB:Q9V9S7	0.044	0.043	2.747E-6	1866	0.136	0.130	Q9V9S7.pdb.gz	SYDE_DROME Rho GTPase-activating protein 100F OS=Drosophila melanogaster OX=7227 GN=RhoGAP100F PE=1 SV=2
10	AFDB:A0A0B4JDC9	0.051	0.050	5.847E-6	1844	0.117	0.113	A0A0B4JDC9.pdb.gz	A0A0B4JDC9_DROME RIM-binding protein, isoform F OS=Drosophila melanogaster OX=7227 GN=Rbp PE=1 SV=1
11	AFDB:Q86UR5	0.043	0.044	1.244E-5	1692	0.115	0.121	Q86UR5.pdb.gz	RIMS1_HUMAN Regulating synaptic membrane exocytosis protein 1 OS=Homo sapiens OX=9606 GN=RIMS1 PE=1 SV=1
12	AFDB:Q961D9	0.031	0.035	6.993E-5	1469	0.135	0.164	Q961D9.pdb.gz	BCL9_DROME Protein BCL9 homolog OS=Drosophila melanogaster OX=7227 GN=lgs PE=1 SV=1
13	PDB:6r9tA	0.050	0.041	5.317E-4	2185	0.014	0.011	6r9tA.pdb.gz
14	PDB:7pcbA	0.039	0.151	2.048E-3	415	0.013	0.055	7pcbA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
15	PDB:7qqnC	0.044	0.174	2.988E-3	414	0.010	0.043	7qqnC.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
16	PDB:7p70A	0.041	0.173	5.709E-3	407	0.008	0.037	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
17	PDB:7pc3A	0.042	0.174	6.360E-3	405	0.011	0.047	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
18	PDB:7qqmA	0.040	0.165	6.712E-3	413	0.011	0.048	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
19	PDB:5n7dA	0.042	0.172	8.329E-3	423	0.010	0.040	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.
20	PDB:7p73A	0.041	0.166	8.329E-3	420	0.011	0.048	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PSX8	0.0	611	1040	0.192	0.329	E9PSX8_RAT Signal-induced proliferation-associated 1 OS=Rattus norvegicus OX=10116 GN=Sipa1 PE=1 SV=1
2	F5GYF8	0.0	1044	1257	0.367	0.519	F5GYF8_HUMAN Signal induced proliferation associated 1 like 1 OS=Homo sapiens OX=9606 GN=SIPA1L1 PE=1 SV=1
3	G3X9J0	0.0	3251	1776	0.909	0.912	SI1L3_MOUSE Signal-induced proliferation-associated 1-like protein 3 OS=Mus musculus OX=10090 GN=Sipa1l3 PE=1 SV=1
4	O35412	0.0	1347	1822	0.494	0.482	SI1L1_RAT Signal-induced proliferation-associated 1-like protein 1 OS=Rattus norvegicus OX=10116 GN=Sipa1l1 PE=1 SV=1
5	O43166	0.0	1168	1804	0.347	0.343	SI1L1_HUMAN Signal-induced proliferation-associated 1-like protein 1 OS=Homo sapiens OX=9606 GN=SIPA1L1 PE=1 SV=4
6	O60292	0.0	3672	1781	1.000	1.000	SI1L3_HUMAN Signal-induced proliferation-associated 1-like protein 3 OS=Homo sapiens OX=9606 GN=SIPA1L3 PE=1 SV=3
7	P46062	0.0	603	1037	0.189	0.325	SIPA1_MOUSE Signal-induced proliferation-associated protein 1 OS=Mus musculus OX=10090 GN=Sipa1 PE=1 SV=2
8	Q6I7S1	0.0	610	1040	0.191	0.328	Q6I7S1_RAT GTPase-activating protein OS=Rattus norvegicus OX=10116 GN=Sipa1 PE=2 SV=1
9	Q8C0T5	0.0	1364	1782	0.491	0.490	SI1L1_MOUSE Signal-induced proliferation-associated 1-like protein 1 OS=Mus musculus OX=10090 GN=Sipa1l1 PE=1 SV=2
10	Q96FS4	0.0	622	1042	0.176	0.301	SIPA1_HUMAN Signal-induced proliferation-associated protein 1 OS=Homo sapiens OX=9606 GN=SIPA1 PE=1 SV=1
11	Q9P2F8	0.0	1268	1722	0.456	0.472	SI1L2_HUMAN Signal-induced proliferation-associated 1-like protein 2 OS=Homo sapiens OX=9606 GN=SIPA1L2 PE=1 SV=2
12	G5EBY5	3.98e-170	545	995	0.162	0.290	G5EBY5_CAEEL Rap-GAP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sipa-1 PE=1 SV=1
13	Q9VM02	1.71e-68	251	850	0.074	0.155	Q9VM02_DROME Rap GTPase activating protein 1, isoform E OS=Drosophila melanogaster OX=7227 GN=RapGAP1 PE=4 SV=1
14	Q9VM00	3.06e-68	252	933	0.074	0.141	Q9VM00_DROME Rap GTPase activating protein 1, isoform D OS=Drosophila melanogaster OX=7227 GN=RapGAP1 PE=4 SV=2
15	O44090	4.58e-68	250	850	0.074	0.154	O44090_DROME GTPase activating protein for Rap1 OS=Drosophila melanogaster OX=7227 GN=RapGAP1 PE=2 SV=1
16	Q59DZ5	5.46e-68	250	876	0.074	0.151	Q59DZ5_DROME Rap GTPase activating protein 1, isoform F OS=Drosophila melanogaster OX=7227 GN=RapGAP1 PE=4 SV=1
17	A8DYW8	1.25e-67	251	959	0.074	0.138	A8DYW8_DROME Rap GTPase activating protein 1, isoform H OS=Drosophila melanogaster OX=7227 GN=RapGAP1 PE=4 SV=2
18	Q5SVL6	1.32e-67	246	712	0.079	0.198	RPGP2_MOUSE Rap1 GTPase-activating protein 2 OS=Mus musculus OX=10090 GN=Rap1gap2 PE=1 SV=1
19	H2L055	1.33e-66	245	811	0.075	0.165	H2L055_CAEEL Rap-GAP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_F53A10.2 PE=1 SV=1
20	Q684P5	3.36e-66	242	730	0.077	0.189	RPGP2_HUMAN Rap1 GTPase-activating protein 2 OS=Homo sapiens OX=9606 GN=RAP1GAP2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11802 CENP-K	9.6e+02	10.7	Centromere-associated protein K
2	PF00595 PDZ	0.56	21.9	PDZ domain
3	PF17820 PDZ_6	1.1e+02	14.2	PDZ domain
4	PF02145 Rap_GAP	1.1e-60	215.8	Rap/ran-GAP
5	PF11881 SPAR_C	1.1e-97	338.1	C-terminal domain of SPAR protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000222345

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000257215	0.608	Sn1-specific diacylglycerol lipase alpha
2	9606.ENSP00000221498	0.588	Dickkopf-like protein 1
3	9606.ENSP00000356549	0.554	Immediate early response gene 5 protein
4	9606.ENSP00000454303	0.554	AP-5 complex subunit beta-1
5	9606.ENSP00000261778	0.526	Transport and golgi organization 6 homolog
6	9606.ENSP00000353496	0.521	Leucine zipper putative tumor suppressor 3
7	9606.ENSP00000469863	0.516	Dual specificity tyrosine-phosphorylation-regulated kinase 1B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0098772	0.804	molecular function regulator activity
GO:0005096	0.327	GTPase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0090162	0.856	establishment of epithelial cell polarity
GO:0032502	0.836	developmental process
GO:0048856	0.799	anatomical structure development
GO:0065007	0.670	biological regulation
GO:0050794	0.587	regulation of cellular process
GO:0003382	0.585	epithelial cell morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0012505	0.997	endomembrane system
GO:0005886	0.997	plasma membrane
GO:0043232	0.995	intracellular non-membrane-bounded organelle
GO:0005654	0.995	nucleoplasm
GO:0030054	0.992	cell junction
GO:0005856	0.929	cytoskeleton
GO:0015629	0.894	actin cytoskeleton
GO:0005576	0.842	extracellular region
GO:0005615	0.669	extracellular space
GO:0070161	0.634	anchoring junction
GO:0005829	0.582	cytosol
GO:0005794	0.453	Golgi apparatus
GO:0005911	0.422	cell-cell junction
GO:0042641	0.311	actomyosin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]