StarFunc result for job id O60293

User Input

>input (1989 residues)
MATADTPAPASSGLSPKEEGELEDGEISDDDNNSQIRSRSSSSSSGGGLLPYPRRRPPHS
ARGGGSGGGGGSSSSSSSSQQQLRNFSRSRHASERGHLRGPSSYRPKEPFRSHPPSVRMP
SSSLSESSPRPSFWERSHLALDRFRFRGRPYRGGSRWSRGRGVGERGGKPGCRPPLGGGA
GSGFSSSQSWREPSPPRKSSKSFGRSPSRKQNYSSKNENCVEETFEDLLLKYKQIQLELE
CINKDEKLALSSKEENVQEDPKTLNFEDQTSTDNVSITKDSSKEVAPEEKTQVKTFQAFE
LKPLRQKLTLPGDKNRLKKVKDGAKPLSLKSDTTDSSQGLQDKEQNLTRRISTSDILSEK
KLGEDEEELSELQLRLLALQSASKKWQQKEQQVMKESKEKLTKTKTVQQKVKTSTKTHSA
KKVSTTAKQALRKQQTKAWKKLQQQKEQERQKEEDQRKQAEEEERRKREEEIRKIRDLSN
QEEQYNRFMKLVGGKRRSRSKSSDPDLRRSLDKQPTDSGGGIYQYDNYEEVAMDTDSETS
SPAPSPVQPPFFSECSLGYFSPAPSLSLPPPPQVSSLPPLSQPYVEGLCVSLEPLPPLPP
LPPLPPEDPEQPPKPPFADEEEEEEMLLREELLKSLANKRAFKPEETSSNSDPPSPPVLN
NSHPVPRSNLSIVSINTVSQPRIQNPKFHRGPRLPRTVISLPKHKSVVVTLNDSDDSESD
GEASKSTNSVFGGLESMIKEARRTAEQASKPKVPPKSEKENDPLRTPEALPEEKKIEYRL
LKEEIANREKQRLIKSDQLKTSSSSPANSDVEIDGIGRIAMVTKQVTDAESKLKKHRILL
MKDESVLKNLVQQEAKKKESVRNAEAKITKLTEQLQATEKILNVNRMFLKKLQEQIHRVQ
QRVTIKKALTLKYGEELARAKAVASKEIGKRKLEQDRFGPNKMMRLDSSPVSSPRKHSAE
LIAMEKRRLQKLEYEYALKIQKLKEARALKAKEQQNISPVVEEEPEFSLPQPSLHDLTQD
KLTLDTEENDVDDEILSGSSRERRRSFLESNYFTKPNLKHTDTANKECINKLNKNTVEKP
ELFLGLKIGELQKLYSKADSLKQLILKTTTGITEKVLHGQEISVDVDFVTAQSKTMEVKP
CPFRPYHSPLLVFKSYRFSPYYRTKEKLPLSSVSYSNMIEPDQCFCRFDLTGTCNDDDCQ
WQHIQDYTLSRKQLFQDILSYNLSLIGCAETSTNEEITASAEKYVEKLFGVNKDRMSMDQ
MAVLLVSNINESKGHTPPFTTYKDKRKWKPKFWRKPISDNSFSSDEEQSTGPIKYAFQPE
NQINVPALDTVVTPDDVRYFTNETDDIANLEASVLENPSHVQLWLKLAYKYLNQNEGECS
ESLDSALNVLARALENNKDNPEIWCHYLRLFSKRGTKDEVQEMCETAVEYAPDYQSFWTF
LHLESTFEEKDYVCERMLEFLMGAAKQETSNILSFQLLEALLFRVQLHIFTGRCQSALAI
LQNALKSANDGIVAEYLKTSDRCLAWLAYIHLIEFNILPSKFYDPSNDNPSRIVNTESFV
MPWQAVQDVKTNPDMLLAVFEDAVKACTDESLAVEERIEACLPLYTNMIALHQLLERYEA
AMELCKSLLESCPINCQLLEALVALYLQTNQHDKARAVWLTAFEKNPQNAEVFYHMCKFF
ILQNRGDNLLPFLRKFIASFFKPGFEKYNNLDLFRYLLNIPGPIDIPSRLCKGNFDDDMF
NHQVPYLWLIYCLCHPLQSSIKETVEAYEAALGVAMRCDIVQKIWMDYLVFANNRAAGSR
NKVQEFKFFTDLVNRCLVTVPARYPIPFSSADYWSNYEFHNRVIFFYLSCVPKTQHSKTL
ERFCSVMPANSGLALRLLQHEWEESNVQILKLQAKMFTYNIPTCLATWKIAIAAEIVLKG
QREVHRLYQRALQKLPLCASLWKDQLLFEASEGGKTDNLRKLVSKCQEIGVSLNELLNLN
SNKTESKNH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60293	1.000	1.000	0.000	1989	1.000	1.000	O60293.pdb.gz	ZC3H1_HUMAN Zinc finger C3H1 domain-containing protein OS=Homo sapiens OX=9606 GN=ZFC3H1 PE=1 SV=3
2	PDB:6tedQ	0.087	0.156	1.134E-8	890	0.051	0.113	6tedQ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
3	PDB:7qdrB	0.076	0.114	3.449E-8	1212	0.047	0.077	7qdrB.pdb.gz
4	PDB:6bq1B	0.093	0.203	1.139E-7	728	0.033	0.091	6bq1B.pdb.gz	Architecture of the human PI4KIII alpha lipid kinase complex.
5	PDB:5o9zG	0.086	0.160	1.719E-7	804	0.055	0.136	5o9zG.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
6	PDB:7dkhI	0.091	0.158	1.945E-7	914	0.051	0.112	7dkhI.pdb.gz
7	PDB:5nrlJ	0.089	0.182	2.817E-7	800	0.053	0.133	5nrlJ.pdb.gz	Structure of a pre-catalytic spliceosome.
8	PDB:4bujB	0.121	0.163	4.432E-7	1367	0.038	0.055	4bujB.pdb.gz
9	PDB:6yj6A	0.082	0.150	5.674E-7	819	0.048	0.116	6yj6A.pdb.gz
10	PDB:5dseA	0.106	0.280	8.220E-7	537	0.031	0.115	5dseA.pdb.gz
11	PDB:8a3tJ	0.088	0.253	9.692E-7	509	0.030	0.116	8a3tJ.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
12	AFDB:Q9W517	0.063	0.069	4.742E-6	1741	0.109	0.125	Q9W517.pdb.gz	WAPL_DROME Protein wings apart-like OS=Drosophila melanogaster OX=7227 GN=wapl PE=1 SV=1
13	AFDB:G0SAK3	0.050	0.054	2.674E-5	1793	0.124	0.138	G0SAK3.pdb.gz	NU145_CHATD Nucleoporin NUP145 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=NUP145 PE=1 SV=1
14	AFDB:O14207	0.065	0.067	6.617E-5	1888	0.100	0.105	O14207.pdb.gz	MMS22_SCHPO Protein mms22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mus7 PE=3 SV=1
15	AFDB:E5FYH1	0.089	0.101	1.085E-4	1653	0.114	0.137	E5FYH1.pdb.gz	TOPZ1_MOUSE Protein TOPAZ1 OS=Mus musculus OX=10090 GN=Topaz1 PE=2 SV=1
16	AFDB:Q9VCH1	0.066	0.064	2.096E-4	2072	0.132	0.127	Q9VCH1.pdb.gz	Q9VCH1_DROME Eukaryotic translation initiation factor 4G2, isoform A OS=Drosophila melanogaster OX=7227 GN=eIF4G2 PE=1 SV=2
17	AFDB:J7SA49	0.072	0.078	2.797E-4	1768	0.111	0.125	J7SA49.pdb.gz	J7SA49_CAEEL ARID domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=let-526 PE=1 SV=1
18	AFDB:Q4LDP4	0.068	0.068	4.222E-4	1931	0.121	0.124	Q4LDP4.pdb.gz	Q4LDP4_DROME Testis-specific gamma-tubulin ring protein 91 OS=Drosophila melanogaster OX=7227 GN=t-Grip91 PE=4 SV=1
19	AFDB:P10180	0.036	0.033	5.632E-4	2175	0.083	0.076	P10180.pdb.gz	CUT_DROME Homeobox protein cut OS=Drosophila melanogaster OX=7227 GN=ct PE=1 SV=1
20	AFDB:O43432	0.060	0.068	7.211E-4	1585	0.101	0.126	O43432.pdb.gz	IF4G3_HUMAN Eukaryotic translation initiation factor 4 gamma 3 OS=Homo sapiens OX=9606 GN=EIF4G3 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G3V1X1	0.0	688	358	0.170	0.947	G3V1X1_HUMAN Proline/serine-rich coiled-coil 2, isoform CRA_a OS=Homo sapiens OX=9606 GN=ZFC3H1 PE=1 SV=1
2	O60293	0.0	4104	1989	1.000	1.000	ZC3H1_HUMAN Zinc finger C3H1 domain-containing protein OS=Homo sapiens OX=9606 GN=ZFC3H1 PE=1 SV=3
3	Q9UTR8	4.76e-12	73.6	712	0.016	0.045	RED1_SCHPO NURS complex subunit red1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=red1 PE=1 SV=2
4	Q9W3D1	0.36	38.5	1183	0.018	0.030	Q9W3D1_DROME Chromatin assembly factor 1, p180 subunit OS=Drosophila melanogaster OX=7227 GN=Caf1-180 PE=1 SV=1
5	Q7KUQ6	0.90	37.0	2147	0.014	0.013	Q7KUQ6_DROME Limpet, isoform K OS=Drosophila melanogaster OX=7227 GN=Lmpt PE=1 SV=2
6	M9MRX0	2.5	35.4	989	0.014	0.028	M9MRX0_DROME Limpet, isoform J OS=Drosophila melanogaster OX=7227 GN=Lmpt PE=1 SV=1
7	Q9QWY8	4.3	34.7	1147	0.015	0.026	ASAP1_MOUSE Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 OS=Mus musculus OX=10090 GN=Asap1 PE=1 SV=2
8	Q7KQM6	4.7	34.7	1574	0.012	0.015	GGYF1_DROME GIGYF family protein Gyf OS=Drosophila melanogaster OX=7227 GN=Gyf PE=1 SV=2
9	Q9VQL8	6.6	34.3	993	0.026	0.052	Q9VQL8_DROME Toucan, isoform B OS=Drosophila melanogaster OX=7227 GN=toc PE=4 SV=1
10	A8DYU0	7.8	33.9	682	0.026	0.076	A8DYU0_DROME Toucan, isoform F OS=Drosophila melanogaster OX=7227 GN=toc PE=4 SV=1
11	M9PBW7	7.8	33.9	840	0.026	0.062	M9PBW7_DROME Toucan, isoform G OS=Drosophila melanogaster OX=7227 GN=toc PE=4 SV=1
12	Q9VQM0	8.2	33.9	2162	0.031	0.028	Q9VQM0_DROME Toucan, isoform A OS=Drosophila melanogaster OX=7227 GN=toc PE=4 SV=2
13	O46112	8.5	33.9	2176	0.031	0.028	O46112_DROME Toucan protein OS=Drosophila melanogaster OX=7227 GN=toc PE=2 SV=1
14	A1Z8M2	9.8	33.9	2999	0.012	0.008	A1Z8M2_DROME Toutatis, isoform A OS=Drosophila melanogaster OX=7227 GN=tou PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10041 DUF2277	2e+02	13.7	Uncharacterized conserved protein (DUF2277)
2	PF01239 PPTA	1e+03	11.0	Protein prenyltransferase alpha subunit repeat
3	PF00515 TPR_1	3.9e+02	12.3	Tetratricopeptide repeat
4	PF13414 TPR_11	0.0056	27.6	TPR repeat
5	PF13424 TPR_12	6.9e+02	12.0	Tetratricopeptide repeat
6	PF13428 TPR_14	7.8e-06	37.2	Tetratricopeptide repeat
7	PF13432 TPR_16	28	16.7	Tetratricopeptide repeat
8	PF13431 TPR_17	2.2	19.9	Tetratricopeptide repeat
9	PF14559 TPR_19	5.9e-08	44.4	Tetratricopeptide repeat
10	PF13181 TPR_8	2.2e+02	13.5	Tetratricopeptide repeat
11	PF10650 zf-C3H1	0.00014	32.8	Putative zinc-finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368017

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000366135	0.981	Exosome component 10
2	9606.ENSP00000323046	0.968	Exosome complex component RRP40
3	9606.ENSP00000230640	0.967	Superkiller viralicidic activity 2-like 2
4	9606.ENSP00000366997	0.967	Exosome complex exonuclease RRP44
5	9606.ENSP00000265564	0.962	Exosome complex component RRP42
6	9606.ENSP00000348107	0.955	Nuclear nucleic acid-binding protein C1D
7	9606.ENSP00000321711	0.953	DIS3-like exonuclease 1
8	9606.ENSP00000258169	0.945	M-phase phosphoprotein 6
9	9606.ENSP00000361433	0.944	Exosome complex component RRP4
10	9606.ENSP00000368984	0.938	Exosome complex component RRP45
11	9606.ENSP00000221233	0.935	Exosome complex component RRP46
12	9606.ENSP00000315476	0.931	Exosome complex component RRP41
13	9606.ENSP00000398597	0.931	Exosome complex component MTR3
14	9606.ENSP00000374354	0.927	Exosome complex component RRP43
15	9606.ENSP00000400646	0.915	Polyribonucleotide nucleotidyltransferase 1, mitochondrial
16	9606.ENSP00000359939	0.911	Exosome complex component CSL4
17	9606.ENSP00000352678	0.900	ATP-dependent RNA helicase SUPV3L1, mitochondrial
18	9606.ENSP00000358242	0.897	Arginine/serine-rich protein PNISR
19	9606.ENSP00000480421	0.869	Serrate RNA effector molecule homolog
20	9606.ENSP00000216727	0.868	Polyadenylate-binding protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.331	heterocyclic compound binding
GO:0097159	0.325	organic cyclic compound binding
GO:0003676	0.320	nucleic acid binding
GO:0003723	0.314	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0009987	0.988	cellular process
GO:0050794	0.981	regulation of cellular process
GO:0019222	0.930	regulation of metabolic process
GO:0071704	0.816	organic substance metabolic process
GO:0060255	0.807	regulation of macromolecule metabolic process
GO:0048519	0.754	negative regulation of biological process
GO:0048523	0.726	negative regulation of cellular process
GO:0051171	0.711	regulation of nitrogen compound metabolic process
GO:0080090	0.703	regulation of primary metabolic process
GO:0031323	0.644	regulation of cellular metabolic process
GO:0043170	0.641	macromolecule metabolic process
GO:0009892	0.536	negative regulation of metabolic process
GO:0044237	0.475	cellular metabolic process
GO:0044238	0.458	primary metabolic process
GO:0006807	0.443	nitrogen compound metabolic process
GO:0019219	0.421	regulation of nucleobase-containing compound metabolic process
GO:0010605	0.400	negative regulation of macromolecule metabolic process
GO:0010468	0.392	regulation of gene expression
GO:0048518	0.359	positive regulation of biological process
GO:0051252	0.355	regulation of RNA metabolic process
GO:1901360	0.316	organic cyclic compound metabolic process
GO:0034641	0.315	cellular nitrogen compound metabolic process
GO:0090304	0.301	nucleic acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005576	0.995	extracellular region
GO:0000178	0.995	exosome (RNase complex)
GO:0005615	0.992	extracellular space
GO:0070013	0.976	intracellular organelle lumen
GO:0005654	0.965	nucleoplasm
GO:0005737	0.804	cytoplasm
GO:0140513	0.463	nuclear protein-containing complex
GO:0043232	0.308	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]