StarFunc result for job id O60296

User Input

>input (914 residues)
MSQSQNAIFTSPTGEENLMNSNHRDSESITDVCSNEDLPEVELVSLLEEQLPQYRLKVDT
LFLYENQDWTQSPHQRQHASDALSPVLAEETFRYMILGTDRVEQMTKTYNDIDMVTHLLA
ERDRDLELAARIGQALLKRNHVLSEQNESLEEQLGQAFDQVNQLQHELCKKDELLRIVSI
ASEESETDSSCSTPLRFNESFSLSQGLLQLEMLQEKLKELEEENMALRSKACHIKTETVT
YEEKEQQLVSDCVKELRETNAQMSRMTEELSGKSDELIRYQEELSSLLSQIVDLQHKLKE
HVIEKEELKLHLQASKDAQRQLTMELHELQDRNMECLGMLHESQEEIKELRSRSGPTAHL
YFSQSYGAFTGESLAAEIEGTMRKKLSLDEESSLFKQKAQQKRVFDTVRIANDTRGRSIS
FPALLPIPGSNRSSVIMTAKPFESGLQQTEDKSLLNQGSSSEEVAGSSQKMGQPGPSGDS
DLATALHRLSLRRQNYLSEKQFFAEEWQRKIQVLADQKEGVSGCVTPTESLASLCTTQSE
ITDLSSASCLRGFMPEKLQIVKPLEGSQTLYHWQQLAQPNLGTILDPRPGVITKGFTQLP
GDAIYHISDLEEDEEEGITFQVQQPLEVEEKLSTSKPVTGIFLPPITSAGGPVTVATANP
GKCLSCTNSTFTFTTCRILHPSDITQVTPSSGFPSLSCGSSGSSSSNTAVNSPALSYRLS
IGESITNRRDSTTTFSSTMSLAKLLQERGISAKVYHSPISENPLQPLPKSLAIPSTPPNS
PSHSPCPSPLPFEPRVHLSENFLASRPAETFLQEMYGLRPSRNPPDVGQLKMNLVDRLKR
LGIARVVKNPGAQENGRCQEAEIGPQKPDSAVYLNSGSSLLGGLRRNQSLPVIMGSFAAP
VCTSSPKMGVLKED

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60296	1.000	1.000	0.000	914	1.000	1.000	O60296.pdb.gz	TRAK2_HUMAN Trafficking kinesin-binding protein 2 OS=Homo sapiens OX=9606 GN=TRAK2 PE=1 SV=2
2	AFDB:Q6P9N8	0.523	0.523	0.000	913	0.875	0.876	Q6P9N8.pdb.gz	Q6P9N8_MOUSE Trafficking protein, kinesin binding 2 OS=Mus musculus OX=10090 GN=Trak2 PE=1 SV=1
3	AFDB:Q9UPV9	0.209	0.202	3.035E-62	953	0.495	0.474	Q9UPV9.pdb.gz	TRAK1_HUMAN Trafficking kinesin-binding protein 1 OS=Homo sapiens OX=9606 GN=TRAK1 PE=1 SV=1
4	AFDB:Q86BG1	0.082	0.072	2.519E-10	1069	0.152	0.130	Q86BG1.pdb.gz	Q86BG1_DROME Ankyrin-repeat, SH3-domain, and Proline-rich-region containing protein, isoform B OS=Drosophila melanogaster OX=7227 GN=ASPP PE=4 SV=1
5	AFDB:P07197	0.139	0.138	8.392E-10	916	0.139	0.139	P07197.pdb.gz	NFM_HUMAN Neurofilament medium polypeptide OS=Homo sapiens OX=9606 GN=NEFM PE=1 SV=3
6	AFDB:P19246	0.115	0.101	1.283E-9	1090	0.159	0.133	P19246.pdb.gz	NFH_MOUSE Neurofilament heavy polypeptide OS=Mus musculus OX=10090 GN=Nefh PE=1 SV=3
7	AFDB:P12036	0.140	0.127	2.426E-9	1026	0.126	0.112	P12036.pdb.gz	NFH_HUMAN Neurofilament heavy polypeptide OS=Homo sapiens OX=9606 GN=NEFH PE=1 SV=4
8	AFDB:E7ESP9	0.094	0.098	6.090E-9	877	0.132	0.138	E7ESP9.pdb.gz	E7ESP9_HUMAN Neurofilament medium chain OS=Homo sapiens OX=9606 GN=NEFM PE=1 SV=1
9	AFDB:P16884	0.106	0.094	3.573E-8	1072	0.147	0.125	P16884.pdb.gz	NFH_RAT Neurofilament heavy polypeptide OS=Rattus norvegicus OX=10116 GN=Nefh PE=1 SV=4
10	AFDB:P08553	0.129	0.137	1.278E-7	848	0.120	0.130	P08553.pdb.gz	NFM_MOUSE Neurofilament medium polypeptide OS=Mus musculus OX=10090 GN=Nefm PE=1 SV=4
11	PDB:7z8fX	0.107	0.294	7.821E-1	269	0.082	0.279	7z8fX.pdb.gz	Structure of dynein-dynactin on microtubules shows tandem adaptor binding.
12	PDB:6govN	0.041	0.227	3.001	110	0.015	0.127	6govN.pdb.gz	Structural Basis for the Action of an All-Purpose Transcription Anti-termination Factor.
13	PDB:7ajuCK	0.038	0.116	4.589	222	0.023	0.095	7ajuCK.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
14	PDB:8at3A	0.091	0.232	4.589	286	0.056	0.178	8at3A.pdb.gz
15	PDB:7d4iBE	0.037	0.038	6.091	890	0.012	0.012	7d4iBE.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
16	PDB:7qooU	0.070	0.257	7.532	186	0.031	0.151	7qooU.pdb.gz	Structure of the human inner kinetochore CCAN complex and its significance for human centromere organization.
17	PDB:7ae1M	0.032	0.056	9.314	400	0.016	0.037	7ae1M.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.
18	PDB:6ip52Q	0.029	0.158	9.997	124	0.016	0.121	6ip52Q.pdb.gz	HCV IRES Captures an Actively Translating 80S Ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZSR6	0.0	713	939	0.496	0.482	A0A8I5ZSR6_RAT Trafficking kinesin protein 1 OS=Rattus norvegicus OX=10116 GN=Trak1 PE=3 SV=1
2	A0A8I6AI05	0.0	724	968	0.501	0.473	A0A8I6AI05_RAT Trafficking kinesin protein 1 OS=Rattus norvegicus OX=10116 GN=Trak1 PE=3 SV=1
3	O60296	0.0	1873	914	1.000	1.000	TRAK2_HUMAN Trafficking kinesin-binding protein 2 OS=Homo sapiens OX=9606 GN=TRAK2 PE=1 SV=2
4	Q6P9N8	0.0	1595	913	0.875	0.876	Q6P9N8_MOUSE Trafficking protein, kinesin binding 2 OS=Mus musculus OX=10090 GN=Trak2 PE=1 SV=1
5	Q6PD31	0.0	720	939	0.500	0.487	TRAK1_MOUSE Trafficking kinesin-binding protein 1 OS=Mus musculus OX=10090 GN=Trak1 PE=1 SV=1
6	Q8R2H7	0.0	1518	913	0.868	0.869	TRAK2_RAT Trafficking kinesin-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Trak2 PE=1 SV=2
7	Q9UPV9	0.0	718	953	0.499	0.478	TRAK1_HUMAN Trafficking kinesin-binding protein 1 OS=Homo sapiens OX=9606 GN=TRAK1 PE=1 SV=1
8	A0A8I5Y2D1	4.58e-178	530	606	0.353	0.533	A0A8I5Y2D1_RAT Trafficking kinesin protein 1 OS=Rattus norvegicus OX=10116 GN=Trak1 PE=3 SV=1
9	A0A8I6A6Q8	1.12e-163	498	733	0.323	0.402	A0A8I6A6Q8_RAT Trafficking kinesin protein 1 OS=Rattus norvegicus OX=10116 GN=Trak1 PE=3 SV=1
10	D4ACC5	7.63e-163	489	560	0.318	0.520	D4ACC5_RAT Trafficking kinesin protein 1 OS=Rattus norvegicus OX=10116 GN=Trak1 PE=1 SV=2
11	Q960V3	7.67e-59	221	1122	0.243	0.198	MILT_DROME Trafficking kinesin-binding protein milt OS=Drosophila melanogaster OX=7227 GN=milt PE=1 SV=1
12	P54257	1.02e-31	134	671	0.115	0.156	HAP1_HUMAN Huntingtin-associated protein 1 OS=Homo sapiens OX=9606 GN=HAP1 PE=1 SV=3
13	P54256	4.37e-25	113	629	0.102	0.148	HAP1_RAT Huntingtin-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Hap1 PE=1 SV=1
14	O35668	5.14e-23	107	628	0.096	0.140	HAP1_MOUSE Huntingtin-associated protein 1 OS=Mus musculus OX=10090 GN=Hap1 PE=1 SV=1
15	A0JNT9	1.56e-05	51.2	577	0.090	0.142	BICL1_MOUSE BICD family-like cargo adapter 1 OS=Mus musculus OX=10090 GN=Bicdl1 PE=1 SV=1
16	B7ZNY0	1.92e-04	48.1	2412	0.057	0.022	B7ZNY0_MOUSE Pde4dip protein OS=Mus musculus OX=10090 GN=Pde4dip PE=1 SV=1
17	Q9WUJ3	2.93e-04	47.4	2324	0.057	0.022	MYOME_RAT Myomegalin OS=Rattus norvegicus OX=10116 GN=Pde4dip PE=1 SV=1
18	O75154	0.008	42.4	756	0.077	0.093	RFIP3_HUMAN Rab11 family-interacting protein 3 OS=Homo sapiens OX=9606 GN=RAB11FIP3 PE=1 SV=1
19	P0CF95	0.024	40.8	569	0.023	0.037	BICL1_DANRE BICD family-like cargo adapter 1 OS=Danio rerio OX=7955 GN=bicdl1 PE=2 SV=1
20	P42566	0.043	40.0	896	0.038	0.039	EPS15_HUMAN Epidermal growth factor receptor substrate 15 OS=Homo sapiens OX=9606 GN=EPS15 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00601 Flu_NS2	4.6e+02	12.5	Influenza non-structural protein (NS2)
2	PF04849 HAP1_N	1e-125	430.7	HAP1 N-terminal conserved region
3	PF12448 Milton	3.8e-27	107.0	Kinesin associated protein
4	PF16553 PUFD	41	15.7	BCORL-PCGF1-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000328875

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351132	0.994	Mitochondrial Rho GTPase 1
2	9606.ENSP00000307078	0.946	Kinesin-1 heavy chain
3	9606.ENSP00000393379	0.932	Kinesin heavy chain isoform 5C
4	9606.ENSP00000274547	0.909	Gamma-aminobutyric acid receptor subunit beta-2
5	9606.ENSP00000340672	0.902	Armadillo repeat-containing X-linked protein 3
6	9606.ENSP00000408979	0.896	Kinesin heavy chain isoform 5A
7	9606.ENSP00000321971	0.875	Mitochondrial Rho GTPase 2
8	9606.ENSP00000319412	0.840	Armadillo repeat-containing protein 10
9	9606.ENSP00000194530	0.821	STE20-related kinase adapter protein beta
10	9606.ENSP00000393097	0.811	Gamma-aminobutyric acid receptor subunit alpha-1
11	9606.ENSP00000362824	0.796	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
12	9606.ENSP00000364204	0.754	Serine/threonine-protein kinase PINK1, mitochondrial
13	9606.ENSP00000367848	0.732	Gamma-aminobutyric acid receptor subunit delta
14	9606.ENSP00000295454	0.726	Gamma-aminobutyric acid receptor subunit beta-1
15	9606.ENSP00000328998	0.712	Trafficking kinesin-binding protein 1
16	9606.ENSP00000359337	0.699	Gamma-aminobutyric acid receptor subunit alpha-3
17	9606.ENSP00000371297	0.699	Syntaphilin
18	9606.ENSP00000414982	0.694	Kinesin light chain 1
19	9606.ENSP00000335592	0.692	Gamma-aminobutyric acid receptor subunit alpha-5
20	9606.ENSP00000264276	0.655	Alsin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019904	0.527	protein domain specific binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0072384	0.990	organelle transport along microtubule
GO:0051646	0.988	mitochondrion localization
GO:0047497	0.976	mitochondrion transport along microtubule
GO:0008088	0.961	axo-dendritic transport
GO:0050789	0.945	regulation of biological process
GO:0050794	0.877	regulation of cellular process
GO:0071840	0.760	cellular component organization or biogenesis
GO:0016043	0.752	cellular component organization
GO:0007275	0.479	multicellular organism development
GO:0048869	0.467	cellular developmental process
GO:0030154	0.447	cell differentiation
GO:0048731	0.411	system development
GO:0048518	0.398	positive regulation of biological process
GO:0009653	0.393	anatomical structure morphogenesis
GO:0048468	0.375	cell development
GO:0007399	0.341	nervous system development
GO:0048522	0.337	positive regulation of cellular process
GO:0050793	0.317	regulation of developmental process
GO:0022603	0.308	regulation of anatomical structure morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.996	endomembrane system
GO:0043227	0.996	membrane-bounded organelle
GO:0043229	0.996	intracellular organelle
GO:0005829	0.996	cytosol
GO:0043231	0.992	intracellular membrane-bounded organelle
GO:0016020	0.952	membrane
GO:0031982	0.760	vesicle
GO:0120025	0.692	plasma membrane bounded cell projection
GO:0043005	0.674	neuron projection
GO:0071944	0.661	cell periphery
GO:0005886	0.637	plasma membrane
GO:0005634	0.610	nucleus
GO:0005739	0.527	mitochondrion
GO:0036477	0.511	somatodendritic compartment
GO:0030424	0.502	axon
GO:0030425	0.445	dendrite
GO:0032991	0.411	protein-containing complex
GO:0031410	0.371	cytoplasmic vesicle
GO:0005768	0.327	endosome
GO:0030427	0.325	site of polarized growth

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]