StarFunc result for job id O60303

User Input

>input (1618 residues)
MDGQTLRKAERSWSCSREKKEGYAKDMVTDFDEKHDEYLILLQQRNRILKHLKSKDPVQL
RLEHLEQGFSVYVNGANSELKSSPRKAIHSDFSRSASHTEGTHDYGRRTLFREAEEALRR
SSRTAPSKVQRRGWHQKSVQIRTEAGPRLHIEPPVDYSDDFELCGDVTLQANNTSEDRPQ
ELRRSLELSVNLQRKQKDCSSDEYDSIEEDILSEPEPEDPALVGHPRHDRPPSSGDWTQK
DVHGEQETEGRSSPGPDTLVVLEFNPASKSHKRERNLSAKRKDNAEVFVPTKPEPNLTPQ
APAVFPDQERMCSRPGSRRERPLSATRKTLCEAEYPEEDASAVLQAIQVENAALQRALLS
RKAEQPASPLQDAEGPPAKPWTSLLEEKEETLELLPITTATTTQEPAGAAGGARAINQAM
DRIGLLGSRQQQKLLKVLQAVESDSAHLGRVVSPTKEQVSDTEDKQRMRADEIKDAIYVT
MEILSNWGNSWWVGLTEVEFFDLNDTKLYVSPHDVDIRNTATPGELGRLVNRNLAGKKDS
SPWTCPFHPPLQLFFVIRNTRQLGDFHLAKIKVRNYWTADGDLDIGAKNVKLYVNRNLIF
NGKLDKGDREAPADHSILVDQKNEKSEQLEEAMNAHSEESKGTHEMAGASGDKELGLGCS
PPAETLADAKLSSQGNVSGKRKNSTNCRKDSLSQLEEYLRLSAVPTSMGDMPSAPATSPP
VKCPPVHEEPSLIQQLENLMGRKICEPPGKTPSWLQPSPTGKDRKQGGRKPKPLWLSPEK
PLAWKGRLPSDDVIGEGPGETEARDKGLRHEPGWGTSRSVNTKERPQRATTKVHSDDSDI
FNQPPNRERPASGRRGSRKDAGSSSHGDDQPASREDTWSSRTPSRSRWRSEQEHTLHESW
SSLSAFDRSHRGRISNTELPGDILDELLQQKSSRHSDLPPSKKGEQPGLSRGQDGYSGET
DAGGDFKIPVLPYGQRLVIDIKSTWGDRHYVGLNGIEIFSSKGEPVQISNIKADPPDINI
LPAYGKDPRVVTNLIDGVNRTQDDMHVWLAPFTRGRSHSITIDFTHPCHVALIRIWNYNK
SRIHSFRGVKDITMLLDTQCIFEGEIAKASGTLAGAPEHFGDTILFTTDDDILEAIFYSD
EMFDLDVGSLDSLQDEEAMRRPSTADGEGDERPFTQAGLGADERIPELELPSSSPVPQVT
TPEPGIYHGICLQLNFTASWGDLHYLGLTGLEVVGKEGQALPIHLHQISASPRDLNELPE
YSDDSRALDKLIDGTNITMEDEHMWLIPFSPGLDHVVTIRLDRAESIAGLRFWNYNKSPE
DTYRGAKIVHVSLDGLCVSPPEGFLIRKGPGNCHFDFAQEILFVDYLRAQLLPQPARRLD
MRSLECASMDYEAPLMPCGFIFQFQLLTSWGDPYYIGLTGLELYDERGEKIPLSENNIAA
FPDSVNSLEGVGGDVRTPDKLIDQVNDTSDGRHMWLAPILPGLVNRVYVIFDLPTTVSMI
KLWNYAKTPHRGVKEFGLLVDDLLVYNGILAMVSHLVGGILPTCEPTVPYHTILFTEDRD
IRHQEKHTTISNQAEDQDVQMMNENQIITNAKRKQSVVDPALRPKTCISEKETRRRRC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60303	1.000	1.000	0.000	1618	1.000	1.000	O60303.pdb.gz	KATIP_HUMAN Katanin-interacting protein OS=Homo sapiens OX=9606 GN=KATNIP PE=1 SV=4
2	AFDB:A8JNQ4	0.037	0.065	3.851E-3	796	0.067	0.136	A8JNQ4.pdb.gz	A8JNQ4_DROME RNA-binding Fox protein 1, isoform I OS=Drosophila melanogaster OX=7227 GN=Rbfox1 PE=4 SV=2
3	AFDB:Q8WX93	0.044	0.048	5.951E-3	1383	0.121	0.141	Q8WX93.pdb.gz	PALLD_HUMAN Palladin OS=Homo sapiens OX=9606 GN=PALLD PE=1 SV=3
4	AFDB:E9Q4Y4	0.044	0.034	9.195E-3	2514	0.133	0.086	E9Q4Y4.pdb.gz	E9Q4Y4_MOUSE Centrosomal protein 192 OS=Mus musculus OX=10090 GN=Cep192 PE=1 SV=1
5	AFDB:Q8TEP8	0.048	0.037	1.969E-2	2537	0.124	0.079	Q8TEP8.pdb.gz	CE192_HUMAN Centrosomal protein of 192 kDa OS=Homo sapiens OX=9606 GN=CEP192 PE=1 SV=3
6	AFDB:P97432	0.037	0.052	3.043E-2	988	0.072	0.117	P97432.pdb.gz	NBR1_MOUSE Next to BRCA1 gene 1 protein OS=Mus musculus OX=10090 GN=Nbr1 PE=1 SV=1
7	PDB:1tg7A	0.040	0.057	6.772E-2	971	0.026	0.043	1tg7A.pdb.gz	Crystal Structures of beta-Galactosidase from Penicillium sp. and its Complex with Galactose
8	PDB:1ca1A	0.054	0.198	7.973E-2	370	0.006	0.027	1ca1A.pdb.gz	Structure of the key toxin in gas gangrene.
9	PDB:1lpaB	0.050	0.147	8.419E-2	449	0.011	0.038	1lpaB.pdb.gz	Interfacial activation of the lipase-procolipase complex by mixed micelles revealed by X-ray crystallography.
10	PDB:1bu8A	0.052	0.160	1.167E-1	446	0.010	0.036	1bu8A.pdb.gz
11	PDB:4nreA	0.051	0.110	1.232E-1	675	0.012	0.028	4nreA.pdb.gz	The structure of human 15-lipoxygenase-2 with a substrate mimic.
12	AFDB:Q1PEP5	0.038	0.061	1.322E-1	636	0.044	0.112	Q1PEP5.pdb.gz	NUCL2_ARATH Nucleolin 2 OS=Arabidopsis thaliana OX=3702 GN=NUCL2 PE=1 SV=1
13	PDB:6oauA	0.049	0.147	1.803E-1	422	0.010	0.038	6oauA.pdb.gz	Structure of lipoprotein lipase in complex with GPIHBP1.
14	AFDB:W5U9R6	0.045	0.070	2.988E-1	879	0.065	0.119	W5U9R6.pdb.gz	W5U9R6_ICTPU Nuclear factor of activated T-cells, cytoplasmic 1 OS=Ictalurus punctatus OX=7998 GN=NFATC1 PE=2 SV=1
15	AFDB:A0A1D5PNG2	0.030	0.045	3.332E-1	890	0.071	0.129	A0A1D5PNG2.pdb.gz
16	AFDB:Q9CAF4	0.029	0.035	3.518E-1	1309	0.099	0.122	Q9CAF4.pdb.gz	NUP1_ARATH Nuclear pore complex protein NUP1 OS=Arabidopsis thaliana OX=3702 GN=NUP1 PE=1 SV=1
17	PDB:2p0mA	0.054	0.118	3.656E-1	662	0.007	0.017	2p0mA.pdb.gz	Conformational flexibility in mammalian 15S-lipoxygenase: Reinterpretation of the crystallographic data.
18	PDB:2iukA	0.048	0.086	3.861E-1	835	0.010	0.019	2iukA.pdb.gz	Crystal Structures of Vegetative Soybean Lipoxygenase Vlx-B and Vlx-D, and Comparisons with Seed Isoforms Lox-1 and Lox-3.
19	PDB:3v99B	0.050	0.114	3.861E-1	639	0.009	0.023	3v99B.pdb.gz	Conversion of human 5-lipoxygenase to a 15-lipoxygenase by a point mutation to mimic phosphorylation at Serine-663.
20	PDB:5wpwA	0.037	0.092	3.861E-1	379	0.019	0.082	5wpwA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60303	0.0	3342	1618	1.000	1.000	KATIP_HUMAN Katanin-interacting protein OS=Homo sapiens OX=9606 GN=KATNIP PE=1 SV=4
2	Q8C753	0.0	2338	1610	0.729	0.733	KATIP_MOUSE Katanin-interacting protein OS=Mus musculus OX=10090 GN=Katnip PE=1 SV=2
3	M9PCJ6	0.73	37.4	18641	0.030	0.003	M9PCJ6_DROME Dumpy, isoform S OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
4	M9PC48	0.76	37.4	18095	0.030	0.003	M9PC48_DROME Dumpy, isoform Y OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
5	Q8WN96	4.5	34.7	2701	0.016	0.010	ITPR2_BOVIN Inositol 1,4,5-trisphosphate receptor type 2 OS=Bos taurus OX=9913 GN=ITPR2 PE=2 SV=1
6	O75001	4.6	34.3	760	0.009	0.018	MCM7_SCHPO DNA replication licensing factor mcm7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mcm7 PE=1 SV=1
7	Q8MQW8	8.8	33.5	1789	0.014	0.013	SPRI_DROME Protein sprint OS=Drosophila melanogaster OX=7227 GN=spri PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14652 DUF4457	4e-194	655.7	Domain of unknown function (DUF4457)
2	PF07738 Sad1_UNC	1.1	20.6	Sad1 / UNC-like C-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261588

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000367476	0.685	Centrosomal protein of 104 kDa
2	9606.ENSP00000245121	0.637	Katanin p60 ATPase-containing subunit A-like 2
3	9606.ENSP00000368982	0.636	Katanin p80 WD40 repeat-containing subunit B1
4	9606.ENSP00000265104	0.623	Dynein heavy chain 5, axonemal
5	9606.ENSP00000262210	0.599	Centrosome and spindle pole-associated protein 1
6	9606.ENSP00000468782	0.593	Zinc finger and BTB domain-containing protein 7C
7	9606.ENSP00000377934	0.562	Kinesin-like protein KIF7
8	9606.ENSP00000377769	0.560	ADP-ribosylation factor-like protein 13B
9	9606.ENSP00000483364	0.539	Tectonic-3
10	9606.ENSP00000278826	0.536	Transmembrane protein 138
11	9606.ENSP00000223208	0.522	Centrosomal protein of 41 kDa
12	9606.ENSP00000219240	0.515	Dihydroorotate dehydrogenase (quinone), mitochondrial
13	9606.ENSP00000469337	0.513	Leucine-rich repeat-containing protein 63

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.648	catalytic activity
GO:1901363	0.300	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0003341	0.976	cilium movement
GO:0099111	0.960	microtubule-based transport
GO:0050877	0.945	nervous system process
GO:0003351	0.900	epithelial cilium movement involved in extracellular fluid movement
GO:0071840	0.456	cellular component organization or biogenesis
GO:0016043	0.437	cellular component organization
GO:0050789	0.410	regulation of biological process
GO:0006996	0.318	organelle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.995	extracellular space
GO:0043227	0.963	membrane-bounded organelle
GO:0005622	0.962	intracellular anatomical structure
GO:0043232	0.950	intracellular non-membrane-bounded organelle
GO:0042995	0.845	cell projection
GO:0005737	0.843	cytoplasm
GO:0120025	0.840	plasma membrane bounded cell projection
GO:0043231	0.830	intracellular membrane-bounded organelle
GO:0005856	0.823	cytoskeleton
GO:0005929	0.804	cilium
GO:0005634	0.747	nucleus
GO:0032991	0.429	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]