StarFunc result for job id O60304

User Input

>input (480 residues)
MATVPGLQPLPTLEQDLEQEEILIVKVEEDFCLEEEPSVETEDPSPETFRQLFRLFCYQE
VAGPREALSRLWELCCRWLRPELRTKEQILELLVLEQFLTVLPGEIQARVREQQPESGEE
AVVLVEGLQRKPRKHRQRGSELLSDDEVPLGIGGQFLKHQAEAQPEDLSLEEEARFSSQQ
PPAQLSHRPQRGPLLWPERGPPAPRHQEMASASPFLSAWSQVPVNLEDVAVYLSGEEPRC
MDPAQRDAPLENEGPGIQLEDGGDGREDAPLRMEWYRVLSARCQGPGHPLPGQRPAPVRG
LVRPDQPRGGPPPGRRASHGADKPYTCPECGKGFSKTSHLTKHQRTHTGERPYKCLVCGK
GFSDRSNFSTHQRVHTGEKPYPCPECGKRFSQSSSLVIHRRTHSGERPYACTQCGKRFNN
SSHFSAHRRTHTGEKPYTCPACGRGFRRGTDLHKHQRTHMGAGSLPTLQPVAPGGPGAKA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60304	1.000	1.000	6.335E-78	480	1.000	1.000	O60304.pdb.gz	ZN500_HUMAN Zinc finger protein 500 OS=Homo sapiens OX=9606 GN=ZNF500 PE=1 SV=2
2	AFDB:Q6P9G9	0.199	0.185	4.230E-29	518	0.319	0.295	Q6P9G9.pdb.gz	ZN449_HUMAN Zinc finger protein 449 OS=Homo sapiens OX=9606 GN=ZNF449 PE=1 SV=3
3	AFDB:Q3ZBY5	0.194	0.200	5.015E-29	466	0.362	0.373	Q3ZBY5.pdb.gz	Q3ZBY5_BOVIN Zinc finger and SCAN domain containing 21 OS=Bos taurus OX=9913 GN=ZSCAN21 PE=2 SV=1
4	AFDB:Q8NF99	0.286	0.258	7.051E-29	534	0.352	0.316	Q8NF99.pdb.gz	ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens OX=9606 GN=ZNF397 PE=1 SV=2
5	AFDB:P10073	0.285	0.279	1.561E-28	491	0.350	0.342	P10073.pdb.gz	ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens OX=9606 GN=ZSCAN22 PE=1 SV=2
6	AFDB:Q86W11	0.272	0.265	1.749E-28	494	0.335	0.326	Q86W11.pdb.gz	ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens OX=9606 GN=ZSCAN30 PE=1 SV=1
7	AFDB:Q96LW9	0.242	0.281	2.074E-28	406	0.346	0.409	Q96LW9.pdb.gz	ZSC31_HUMAN Zinc finger and SCAN domain-containing protein 31 OS=Homo sapiens OX=9606 GN=ZSCAN31 PE=1 SV=2
8	AFDB:Q9NX65	0.287	0.200	2.603E-28	697	0.425	0.293	Q9NX65.pdb.gz	ZSC32_HUMAN Zinc finger and SCAN domain-containing protein 32 OS=Homo sapiens OX=9606 GN=ZSCAN32 PE=1 SV=3
9	AFDB:Q07231	0.223	0.194	1.899E-27	555	0.348	0.301	Q07231.pdb.gz	ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus OX=10090 GN=Zscan21 PE=2 SV=2
10	AFDB:Q8IWY8	0.321	0.192	2.825E-27	852	0.440	0.248	Q8IWY8.pdb.gz	ZSC29_HUMAN Zinc finger and SCAN domain-containing protein 29 OS=Homo sapiens OX=9606 GN=ZSCAN29 PE=1 SV=2
11	PDB:3w5kB	0.097	0.258	1.748E-4	110	0.092	0.400	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:5dkaA	0.054	0.163	9.246E-1	96	0.033	0.167	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
13	PDB:7r24A	0.079	0.233	2.047	150	0.031	0.100	7r24A.pdb.gz
14	PDB:7pksh	0.071	0.048	2.569	887	0.040	0.021	7pksh.pdb.gz	Structural basis of Integrator-mediated transcription regulation.
15	PDB:6ff4t	0.047	0.102	2.878	172	0.060	0.169	6ff4t.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
16	PDB:5gm6a	0.039	0.106	3.823	123	0.048	0.187	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
17	PDB:6vvoB	0.076	0.106	4.047	316	0.019	0.028	6vvoB.pdb.gz	Structure of the human clamp loader bound to the sliding clamp: a further twist on AAA+ mechanism
18	PDB:7dvqM	0.045	0.096	4.533	191	0.069	0.173	7dvqM.pdb.gz	Structure of the activated human minor spliceosome.
19	PDB:7u05B	0.083	0.052	5.689	815	0.027	0.016	7u05B.pdb.gz
20	PDB:6hivBI	0.067	0.093	6.746	319	0.027	0.041	6hivBI.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60304	0.0	971	480	1.000	1.000	ZN500_HUMAN Zinc finger protein 500 OS=Homo sapiens OX=9606 GN=ZNF500 PE=1 SV=2
2	O14771	1.05e-94	296	459	0.412	0.431	ZN213_HUMAN Zinc finger protein 213 OS=Homo sapiens OX=9606 GN=ZNF213 PE=1 SV=2
3	Q15776	1.15e-94	299	578	0.417	0.346	ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens OX=9606 GN=ZKSCAN8 PE=1 SV=2
4	P17029	1.86e-91	291	563	0.425	0.362	ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens OX=9606 GN=ZKSCAN1 PE=1 SV=3
5	Q96LW9	1.79e-89	280	406	0.377	0.446	ZSC31_HUMAN Zinc finger and SCAN domain-containing protein 31 OS=Homo sapiens OX=9606 GN=ZSCAN31 PE=1 SV=2
6	Q9BRR0	1.79e-88	282	538	0.404	0.361	ZKSC3_HUMAN Zinc finger protein with KRAB and SCAN domains 3 OS=Homo sapiens OX=9606 GN=ZKSCAN3 PE=1 SV=2
7	O14978	5.40e-86	280	683	0.452	0.318	ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens OX=9606 GN=ZNF263 PE=1 SV=2
8	A0A0S2Z658	2.57e-85	274	545	0.406	0.358	A0A0S2Z658_HUMAN Zinc finger with KRAB and SCAN domains 4 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=ZKSCAN4 PE=2 SV=1
9	Q969J2	2.57e-85	274	545	0.406	0.358	ZKSC4_HUMAN Zinc finger protein with KRAB and SCAN domains 4 OS=Homo sapiens OX=9606 GN=ZKSCAN4 PE=1 SV=1
10	Q6NSZ9	1.88e-84	272	544	0.419	0.369	ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens OX=9606 GN=ZSCAN25 PE=1 SV=3
11	Q9Y5A6	1.17e-83	268	473	0.394	0.400	ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens OX=9606 GN=ZSCAN21 PE=1 SV=2
12	Q3ZBY5	3.65e-82	263	466	0.369	0.380	Q3ZBY5_BOVIN Zinc finger and SCAN domain containing 21 OS=Bos taurus OX=9913 GN=ZSCAN21 PE=2 SV=1
13	Q6P9G9	5.16e-78	254	518	0.356	0.330	ZN449_HUMAN Zinc finger protein 449 OS=Homo sapiens OX=9606 GN=ZNF449 PE=1 SV=3
14	Q8CB76	1.39e-77	253	518	0.358	0.332	Q8CB76_MOUSE Zinc finger protein 449 OS=Mus musculus OX=10090 GN=Zfp449 PE=1 SV=1
15	O43309	4.01e-75	249	611	0.356	0.280	ZSC12_HUMAN Zinc finger and SCAN domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ZSCAN12 PE=1 SV=2
16	Q9Y2L8	1.55e-74	252	839	0.379	0.217	ZKSC5_HUMAN Zinc finger protein with KRAB and SCAN domains 5 OS=Homo sapiens OX=9606 GN=ZKSCAN5 PE=1 SV=1
17	P49910	1.99e-72	239	485	0.360	0.357	ZN165_HUMAN Zinc finger protein 165 OS=Homo sapiens OX=9606 GN=ZNF165 PE=1 SV=1
18	Q53Z40	1.99e-72	239	485	0.360	0.357	Q53Z40_HUMAN HCG1 protein OS=Homo sapiens OX=9606 GN=ZNF165 PE=1 SV=1
19	Q8CF60	9.76e-68	231	680	0.392	0.276	ZN263_MOUSE Zinc finger protein 263 OS=Mus musculus OX=10090 GN=Znf263 PE=1 SV=1
20	Q9H4T2	3.33e-65	216	348	0.304	0.420	ZSC16_HUMAN Zinc finger and SCAN domain-containing protein 16 OS=Homo sapiens OX=9606 GN=ZSCAN16 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07975 C1_4	58	15.3	TFIIH C1-like domain
2	PF14353 CpXC	23	16.5	CpXC protein
3	PF19126 DUF5810	39	15.8	Family of unknown function (DUF5810)
4	PF12773 DZR	0.06	24.7	Double zinc ribbon
5	PF09538 FYDLN_acid	1e+02	15.0	Protein of unknown function (FYDLN_acid)
6	PF12833 HTH_18	9.4	17.9	Helix-turn-helix domain
7	PF01155 HypA	2.7e+02	13.0	Hydrogenase/urease nickel incorporation, metallochaperone, hypA
8	PF01352 KRAB	0.052	24.5	KRAB box
9	PF14446 Prok-RING_1	61	15.0	Prokaryotic RING finger family 1
10	PF02023 SCAN	1.9e-37	138.3	SCAN domain
11	PF01096 TFIIS_C	2.4e+02	13.0	Transcription factor S-II (TFIIS)
12	PF01286 XPA_N	5.4e+02	12.0	XPA protein N-terminal
13	PF14149 YhfH	1.4e+02	13.8	YhfH-like protein
14	PF00096 zf-C2H2	1.3e-26	102.7	Zinc finger, C2H2 type
15	PF13894 zf-C2H2_4	2.4e-17	73.1	C2H2-type zinc finger
16	PF13912 zf-C2H2_6	2.4e-05	35.5	C2H2-type zinc finger
17	PF12171 zf-C2H2_jaz	4e-12	57.3	Zinc-finger double-stranded RNA-binding
18	PF05605 zf-Di19	0.023	26.3	Drought induced 19 protein (Di19), zinc-binding
19	PF13465 zf-H2C2_2	1.6e-32	121.7	Zinc-finger double domain
20	PF04438 zf-HIT	3.2e+02	12.6	HIT zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000219478

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000451998	0.735	Echinoderm microtubule-associated protein-like 5
2	9606.ENSP00000254488	0.701	Sodium- and chloride-dependent GABA transporter 3
3	9606.ENSP00000381773	0.698	DNA topoisomerase 3-beta-1
4	9606.ENSP00000345502	0.694	cAMP-specific 3',5'-cyclic phosphodiesterase 4D
5	9606.ENSP00000268184	0.692	CREB-regulated transcription coactivator 3
6	9606.ENSP00000355523	0.674	Regulator of G-protein signaling 7
7	9606.ENSP00000380479	0.593	ELAV-like protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.517	organic cyclic compound binding
GO:1901363	0.515	heterocyclic compound binding
GO:0003676	0.308	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006355	0.985	regulation of DNA-templated transcription
GO:0048518	0.922	positive regulation of biological process
GO:0009893	0.883	positive regulation of metabolic process
GO:0048523	0.874	negative regulation of cellular process
GO:0048522	0.860	positive regulation of cellular process
GO:0009891	0.814	positive regulation of biosynthetic process
GO:0031325	0.797	positive regulation of cellular metabolic process
GO:0031328	0.784	positive regulation of cellular biosynthetic process
GO:0010604	0.772	positive regulation of macromolecule metabolic process
GO:1903508	0.755	positive regulation of nucleic acid-templated transcription
GO:0045893	0.754	positive regulation of DNA-templated transcription
GO:0051253	0.692	negative regulation of RNA metabolic process
GO:0031327	0.687	negative regulation of cellular biosynthetic process
GO:0009987	0.600	cellular process
GO:0010558	0.543	negative regulation of macromolecule biosynthetic process
GO:1902679	0.413	negative regulation of RNA biosynthetic process
GO:1903507	0.384	negative regulation of nucleic acid-templated transcription
GO:0006357	0.338	regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.995	nuclear lumen
GO:0005654	0.992	nucleoplasm
GO:0005737	0.985	cytoplasm
GO:0005829	0.950	cytosol
GO:0016020	0.336	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]