StarFunc result for job id O60306

User Input

>input (1485 residues)
MAAPAQPKKIVAPTVSQINAEFVTQLACKYWAPHIKKKSPFDIKVIEDIYEKEIVKSRFA
IRKIMLLEFSQYLENYLWMNYSPEVSSKAYLMSICCMVNEKFRENVPAWEIFKKKPDHFP
FFFKHILKAALAETDGEFSLHEQTVLLLFLDHCFNSLEVDLIRSQVQQLISLPMWMGLQL
ARLELELKKTPKLRKFWNLIKKNDEKMDPEAREQAYQERRFLSQLIQKFISVLKSVPLSE
PVTMDKVHYCERFIELMIDLEALLPTRRWFNTILDDSHLLVHCYLSNLVRREEDGHLFSQ
LLDMLKFYTGFEINDQTGNALTENEMTTIHYDRITSLQRAAFAHFPELYDFALSNVAEVD
TRESLVKFFGPLSSNTLHQVASYLCLLPTLPKNEDTTFDKEFLLELLVSRHERRISQIQQ
LNQMPLYPTEKIIWDENIVPTEYYSGEGCLALPKLNLQFLTLHDYLLRNFNLFRLESTYE
IRQDIEDSVSRMKPWQSEYGGVVFGGWARMAQPIVAFTVVEVAKPNIGENWPTRVRADVT
INLNVRDHIKDEWEGLRKHDVCFLITVRPTKPYGTKFDRRRPFIEQVGLVYVRGCEIQGM
LDDKGRVIEDGPEPRPNLRGESRTFRVFLDPNQYQQDMTNTIQNGAEDVYETFNIIMRRK
PKENNFKAVLETIRNLMNTDCVVPDWLHDIILGYGDPSSAHYSKMPNQIATLDFNDTFLS
IEHLKASFPGHNVKVTVEDPALQIPPFRITFPVRSGKGKKRKDADVEDEDTEEAKTLIVE
PHVIPNRGPYPYNQPKRNTIQFTHTQIEAIRAGMQPGLTMVVGPPGTGKTDVAVQIISNI
YHNFPEQRTLIVTHSNQALNQLFEKIMALDIDERHLLRLGHGEEELETEKDFSRYGRVNY
VLARRIELLEEVKRLQKSLGVPGDASYTCETAGYFFLYQVMSRWEEYISKVKNKGSTLPD
VTEVSTFFPFHEYFANAPQPIFKGRSYEEDMEIAEGCFRHIKKIFTQLEEFRASELLRSG
LDRSKYLLVKEAKIIAMTCTHAALKRHDLVKLGFKYDNILMEEAAQILEIETFIPLLLQN
PQDGFSRLKRWIMIGDHHQLPPVIKNMAFQKYSNMEQSLFTRFVRVGVPTVDLDAQGRAR
ASLCNLYNWRYKNLGNLPHVQLLPEFSTANAGLLYDFQLINVEDFQGVGESEPNPYFYQN
LGEAEYVVALFMYMCLLGYPADKISILTTYNGQKHLIRDIINRRCGNNPLIGRPNKVTTV
DRFQGQQNDYILLSLVRTRAVGHLRDVRRLVVAMSRARLGLYIFARVSLFQNCFELTPAF
SQLTARPLHLHIIPTEPFPTTRKNGERPSHEVQIIKNMPQMANFVYNMYMHLIQTTHHYH
QTLLQLPPAMVEEGEEVQNQETELETEEEAMTVQADIIPSPTDTSCRQETPAFQTDTTPS
ETGATSTPEAIPALSETTPTVVGAVSAPAEANTPQDATSAPEETK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:4pj3A	0.883	0.981	0.000	1335	0.895	0.996	4pj3A.pdb.gz	The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes.
2	AFDB:O60306	1.000	1.000	0.000	1485	1.000	1.000	O60306.pdb.gz	AQR_HUMAN RNA helicase aquarius OS=Homo sapiens OX=9606 GN=AQR PE=1 SV=4
3	AFDB:Q7KSN8	0.894	0.893	0.000	1486	0.614	0.614	Q7KSN8.pdb.gz	Q7KSN8_DROME Uncharacterized protein, isoform D OS=Drosophila melanogaster OX=7227 GN=CG14729 PE=1 SV=2
4	AFDB:O94508	0.769	0.882	5.539E-76	1284	0.209	0.241	O94508.pdb.gz	CWF11_SCHPO Pre-mRNA-splicing factor cwf11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cwf11 PE=1 SV=1
5	PDB:3jb9X	0.739	0.910	6.330E-58	1195	0.189	0.234	3jb9X.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
6	AFDB:Q582F1	0.294	0.499	9.366E-27	842	0.116	0.204	Q582F1.pdb.gz	Q582F1_TRYB2 Regulator of nonsense transcripts 1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.3C6.50 PE=3 SV=1
7	AFDB:P30771	0.290	0.431	1.229E-26	971	0.100	0.153	P30771.pdb.gz	RENT1_YEAST ATP-dependent helicase NAM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NAM7 PE=1 SV=1
8	AFDB:O76512	0.297	0.403	3.997E-26	1069	0.105	0.146	O76512.pdb.gz	RENT1_CAEEL Regulator of nonsense transcripts 1 OS=Caenorhabditis elegans OX=6239 GN=smg-2 PE=1 SV=1
9	AFDB:Q09820	0.297	0.465	9.459E-26	925	0.100	0.161	Q09820.pdb.gz	RENT1_SCHPO ATP-dependent helicase upf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=upf1 PE=3 SV=2
10	PDB:5eanA	0.283	0.385	3.064E-21	1051	0.103	0.146	5eanA.pdb.gz	Dna2 nuclease-helicase structure, mechanism and regulation by Rpa.
11	PDB:1uaaA	0.128	0.275	3.067E-7	636	0.052	0.121	1uaaA.pdb.gz	Major domain swiveling revealed by the crystal structures of complexes of E. coli Rep helicase bound to single-stranded DNA and ADP.
12	PDB:2is6A	0.163	0.339	3.847E-7	654	0.055	0.124	2is6A.pdb.gz	UvrD helicase unwinds DNA one base pair at a time by a two-part power stroke.
13	PDB:2is4B	0.164	0.358	4.213E-7	632	0.054	0.127	2is4B.pdb.gz	UvrD helicase unwinds DNA one base pair at a time by a two-part power stroke.
14	PDB:3u44A	0.145	0.184	4.612E-7	1122	0.069	0.092	3u44A.pdb.gz	Insights into Chi recognition from the structure of an AddAB-type helicase-nuclease complex.
15	PDB:1w36B	0.151	0.189	5.530E-7	1158	0.055	0.070	1w36B.pdb.gz	Crystal Structure of Recbcd Enzyme Reveals a Machine for Processing DNA Breaks
16	PDB:4cejA	0.161	0.198	1.499E-6	1177	0.065	0.082	4cejA.pdb.gz	Structural Basis for Translocation by Addab Helicase-Nuclease and its Arrest at Chi Sites.
17	PDB:6sjbB	0.166	0.212	3.097E-6	1129	0.062	0.081	6sjbB.pdb.gz	A conformational switch in response to Chi converts RecBCD from phage destruction to DNA repair.
18	AFDB:Q9NZC9	0.154	0.227	6.508E-4	954	0.047	0.073	Q9NZC9.pdb.gz	SMAL1_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Homo sapiens OX=9606 GN=SMARCAL1 PE=1 SV=1
19	AFDB:A0A1D8PGK4	0.178	0.160	2.424E-3	1690	0.051	0.044	A0A1D8PGK4.pdb.gz	A0A1D8PGK4_CANAL SWI/SNF catalytic subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SNF2 PE=4 SV=1
20	AFDB:Q8I3W6	0.127	0.130	1.951E-2	1441	0.072	0.074	Q8I3W6.pdb.gz	Q8I3W6_PLAF7 DNA 3'-5' helicase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0514100 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60306	0.0	3097	1485	1.000	1.000	AQR_HUMAN RNA helicase aquarius OS=Homo sapiens OX=9606 GN=AQR PE=1 SV=4
2	Q7KSN8	0.0	1844	1486	0.621	0.620	Q7KSN8_DROME Uncharacterized protein, isoform D OS=Drosophila melanogaster OX=7227 GN=CG14729 PE=1 SV=2
3	Q8L5Y4	0.0	1344	1509	0.481	0.474	Q8L5Y4_ARATH P-loop containing nucleoside triphosphate hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=EMB2765 PE=1 SV=1
4	Q8MQK8	0.0	1352	1006	0.453	0.668	Q8MQK8_DROME GM03621p (Fragment) OS=Drosophila melanogaster OX=7227 GN=CG14730 PE=2 SV=1
5	Q8MSA2	0.0	1134	872	0.385	0.656	Q8MSA2_DROME LP02069p OS=Drosophila melanogaster OX=7227 GN=CG14730 PE=2 SV=1
6	Q9U1Q7	0.0	1496	1467	0.512	0.518	Q9U1Q7_CAEEL Intron-binding protein aquarius OS=Caenorhabditis elegans OX=6239 GN=emb-4 PE=1 SV=4
7	Q9VGG9	0.0	1836	1483	0.620	0.620	Q9VGG9_DROME RE35509p OS=Drosophila melanogaster OX=7227 GN=CG14729 PE=1 SV=4
8	O94508	4.44e-85	308	1284	0.222	0.257	CWF11_SCHPO Pre-mRNA-splicing factor cwf11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cwf11 PE=1 SV=1
9	Q8R151	7.11e-28	125	1909	0.064	0.050	ZNFX1_MOUSE NFX1-type zinc finger-containing protein 1 OS=Mus musculus OX=10090 GN=Znfx1 PE=1 SV=3
10	Q9P2E3	3.55e-27	123	1918	0.067	0.052	ZNFX1_HUMAN NFX1-type zinc finger-containing protein 1 OS=Homo sapiens OX=9606 GN=ZNFX1 PE=1 SV=2
11	O94387	1.43e-23	111	1944	0.096	0.074	YGSA_SCHPO Uncharacterized ATP-dependent helicase C29A10.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC29A10.10c PE=3 SV=1
12	Q9FJR0	7.96e-23	108	1254	0.059	0.069	RENT1_ARATH Regulator of nonsense transcripts 1 homolog OS=Arabidopsis thaliana OX=3702 GN=UPF1 PE=1 SV=2
13	Q00416	3.49e-22	107	2231	0.094	0.062	SEN1_YEAST Helicase SEN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEN1 PE=1 SV=2
14	P30771	1.37e-21	104	971	0.059	0.091	RENT1_YEAST ATP-dependent helicase NAM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NAM7 PE=1 SV=1
15	O74465	6.65e-21	102	999	0.062	0.092	HRR1_SCHPO Helicase required for RNAi-mediated heterochromatin assembly 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hrr1 PE=1 SV=2
16	F1RCY6	1.43e-20	101	1100	0.059	0.079	RENT1_DANRE Regulator of nonsense transcripts 1 OS=Danio rerio OX=7955 GN=upf1 PE=2 SV=1
17	Q9EPU0	2.42e-20	100	1124	0.058	0.077	RENT1_MOUSE Regulator of nonsense transcripts 1 OS=Mus musculus OX=10090 GN=Upf1 PE=1 SV=2
18	Q92355	2.54e-20	100	1687	0.093	0.082	SEN1_SCHPO Helicase sen1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sen1 PE=1 SV=1
19	A0A024R7L5	2.83e-20	100	1118	0.058	0.077	A0A024R7L5_HUMAN UPF1 OS=Homo sapiens OX=9606 GN=UPF1 PE=2 SV=1
20	Q92900	3.49e-20	100	1129	0.058	0.076	RENT1_HUMAN Regulator of nonsense transcripts 1 OS=Homo sapiens OX=9606 GN=UPF1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	23	16.9	ATPase family associated with various cellular activities (AAA)
2	PF13086 AAA_11	5.7e-25	100.2	AAA domain
3	PF13087 AAA_12	1.2e-21	88.8	AAA domain
4	PF13191 AAA_16	18	17.1	AAA ATPase domain
5	PF13245 AAA_19	0.00012	33.7	AAA domain
6	PF13401 AAA_22	3.7e+02	12.8	AAA domain
7	PF13604 AAA_30	0.076	24.3	AAA domain
8	PF16399 Aquarius_N	0	1067.1	Intron-binding protein aquarius N-terminus
9	PF00270 DEAD	11	17.3	DEAD/DEAH box helicase
10	PF03796 DnaB_C	22	15.8	DnaB-like helicase C terminal domain
11	PF09848 DUF2075	4.9	17.9	Schlafen group 3, DNA/RNA helicase domain
12	PF01057 Parvo_NS1	2.6	18.7	Parvovirus non-structural protein NS1
13	PF02562 PhoH	1.8e+02	13.0	PhoH-like protein
14	PF00154 RecA	7.2e+02	11.0	recA bacterial DNA recombination protein
15	PF04851 ResIII	0.035	25.6	Type III restriction enzyme, res subunit
16	PF00580 UvrD-helicase	23	16.0	UvrD/REP helicase N-terminal domain
17	PF13538 UvrD_C_2	14	16.9	UvrD-like helicase C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000156471

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000227524	0.999	Pre-mRNA-processing factor 19
2	9606.ENSP00000351137	0.999	Pre-mRNA-splicing factor SYF1
3	9606.ENSP00000357928	0.999	Pre-mRNA-processing factor 17
4	9606.ENSP00000360532	0.999	Cell division cycle 5-like protein
5	9606.ENSP00000392094	0.999	116 kDa U5 small nuclear ribonucleoprotein component
6	9606.ENSP00000460348	0.999	Pre-mRNA-processing-splicing factor 8
7	9606.ENSP00000254193	0.997	U2 small nuclear ribonucleoprotein A
8	9606.ENSP00000262415	0.997	ATP-dependent RNA helicase DHX8
9	9606.ENSP00000358554	0.997	Pre-mRNA-splicing factor SPF27
10	9606.ENSP00000366557	0.997	Crooked neck-like protein 1
11	9606.ENSP00000386023	0.997	Protein BUD31 homolog
12	9606.ENSP00000199814	0.996	Pre-mRNA-splicing factor RBM22
13	9606.ENSP00000236273	0.995	Pre-mRNA-splicing factor SYF2
14	9606.ENSP00000261531	0.995	SNW domain-containing protein 1
15	9606.ENSP00000424417	0.994	Pleiotropic regulator 1
16	9606.ENSP00000215829	0.993	Small nuclear ribonucleoprotein Sm D3
17	9606.ENSP00000263694	0.993	U5 small nuclear ribonucleoprotein 40 kDa protein
18	9606.ENSP00000300413	0.993	Small nuclear ribonucleoprotein Sm D1
19	9606.ENSP00000342374	0.993	Small nuclear ribonucleoprotein Sm D2
20	9606.ENSP00000475615	0.993	Spliceosome-associated protein CWC15 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003724	1.000	RNA helicase activity
GO:0003727	0.999	single-stranded RNA binding
GO:0034458	0.854	3'-5' RNA helicase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0090304	0.996	nucleic acid metabolic process
GO:0008380	0.990	RNA splicing
GO:0016071	0.985	mRNA metabolic process
GO:0000398	0.959	mRNA splicing, via spliceosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.994	protein-containing complex
GO:0140513	0.967	nuclear protein-containing complex
GO:0016020	0.960	membrane
GO:1902494	0.927	catalytic complex
GO:0005681	0.927	spliceosomal complex
GO:0071013	0.917	catalytic step 2 spliceosome
GO:0005684	0.894	U2-type spliceosomal complex
GO:0071007	0.774	U2-type catalytic step 2 spliceosome
GO:0005737	0.347	cytoplasm
GO:0071011	0.327	precatalytic spliceosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.6.4.13	1.000	RNA helicase.

[back to server]