StarFunc result for job id O60307

User Input

>input (1309 residues)
MDESSLLRRRGLQKELSLPRRGRGCRSGNRKSLVVGTPSPTLSRPLSPLSVPTAGSSPLD
SPRNFSAASALNFPFARRADGRRWSLASLPSSGYGTNTPSSTLSSSSSSRERLHQLPFQP
TPDELHFLSKHFRSSENVLDEEGGRSPRLRPRSRSLSPGRATGTFDNEIVMMNHVYRERF
PKATAQMEGRLQEFLTAYAPGARLALADGVLGFIHHQIVELARDCLAKSGENLVTSRYFL
EMQEKLERLLQDAHERSDSEEVSFIVQLVRKLLIIISRPARLLECLEFDPEEFYHLLEAA
EGHAREGQGIKTDLPQYIIGQLGLAKDPLEEMVPLSHLEEEQPPAPESPESRALVGQSRR
KPCESDFETIKLISNGAYGAVYLVRHRDTRQRFAIKKINKQNLILRNQIQQVFVERDILT
FAENPFVVSMFCSFETRRHLCMVMEYVEGGDCATLLKNMGPLPVDMARLYFAETVLALEY
LHNYGIVHRDLKPDNLLITSLGHIKLTDFGLSKIGLMSMATNLYEGHIEKDAREFIDKQV
CGTPEYIAPEVIFRQGYGKPVDWWAMGVVLYEFLVGCVPFFGDTPEELFGQVVSDEIMWP
EGDEALPADAQDLITRLLRQSPLDRLGTGGTHEVKQHPFFLALDWAGLLRHKAEFVPQLE
AEDDTSYFDTRSERYRHLGSEDDETNDEESSTEIPQFSSCSHRFSKVYSSSEFLAVQPTP
TFAERSFSEDREEGWERSEVDYGRRLSADIRLRSWTSSGSSCQSSSSQPERGPSPSLLNT
ISLDTMPKFAFSSEDEGVGPGPAGPKRPVFILGEPDPPPAATPVMPKPSSLSADTAALSH
ARLRSNSIGARHSTPRPLDAGRGRRLGGPRDPAPEKSRASSSGGSGGGSGGRVPKSASVS
ALSLIITADDGSGGPLMSPLSPRSLSSNPSSRDSSPSRDPSPVCGSLRPPIVIHSSGKKY
GFSLRAIRVYMGDSDVYTVHHVVWSVEDGSPAQEAGLRAGDLITHINGESVLGLVHMDVV
ELLLKSGNKISLRTTALENTSIKVGPARKNVAKGRMARRSKRSRRRETQDRRKSLFKKIS
KQTSVLHTSRSFSSGLHHSLSSSESLPGSPTHSLSPSPTTPCRSPAPDVPADTTASPPSA
SPSSSSPASPAAAGHTRPSSLHGLAAKLGPPRPKTGRRKSTSSIPPSPLACPPISAPPPR
SPSPLPGHPPAPARSPRLRRGQSADKLGTGERLDGEAGRRTRGPEAELVVMRRLHLSERR
DSFKKQEAVQEVSFDEPQEEATGLPTSVPQIAVEGEEAVPVALGPTGRD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60307	0.999	0.999	0.000	1309	1.000	1.000	O60307.pdb.gz	MAST3_HUMAN Microtubule-associated serine/threonine-protein kinase 3 OS=Homo sapiens OX=9606 GN=MAST3 PE=1 SV=2
2	AFDB:Q60592	0.357	0.278	0.000	1734	0.615	0.464	Q60592.pdb.gz	MAST2_MOUSE Microtubule-associated serine/threonine-protein kinase 2 OS=Mus musculus OX=10090 GN=Mast2 PE=1 SV=1
3	AFDB:F1MYJ4	0.242	0.640	1.133E-30	479	0.100	0.273	F1MYJ4.pdb.gz	F1MYJ4_BOVIN non-specific serine/threonine protein kinase OS=Bos taurus OX=9913 GN=AKT3 PE=3 SV=2
4	AFDB:A0A0B8RZS0	0.237	0.628	1.865E-30	481	0.103	0.281	A0A0B8RZS0.pdb.gz	A0A0B8RZS0_PIG non-specific serine/threonine protein kinase OS=Sus scrofa domesticus OX=9825 GN=AKT2 PE=3 SV=1
5	AFDB:Q8UUX0	0.238	0.631	4.570E-30	479	0.107	0.292	Q8UUX0.pdb.gz	Q8UUX0_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=cb945 PE=1 SV=1
6	AFDB:Q8I4W3	0.264	0.457	2.248E-29	735	0.121	0.216	Q8I4W3.pdb.gz	Q8I4W3_PLAF7 RAC-beta serine/threonine protein kinase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1246900 PE=4 SV=1
7	AFDB:Q9XTG7	0.225	0.543	3.308E-28	528	0.095	0.235	Q9XTG7.pdb.gz	AKT2_CAEEL Serine/threonine-protein kinase akt-2 OS=Caenorhabditis elegans OX=6239 GN=akt-2 PE=1 SV=1
8	PDB:6byrA	0.213	0.676	4.986E-27	405	0.099	0.321	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
9	AFDB:Q9TW45	0.197	0.215	1.755E-25	1192	0.176	0.194	Q9TW45.pdb.gz	PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans OX=6239 GN=par-1 PE=1 SV=1
10	PDB:3pfqA	0.210	0.514	5.311E-24	523	0.079	0.197	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
11	PDB:5x3fB	0.200	0.719	6.167E-24	349	0.090	0.338	5x3fB.pdb.gz
12	AFDB:Q9W532	0.201	0.188	1.336E-23	1398	0.163	0.152	Q9W532.pdb.gz	Q9W532_DROME FI24002p1 OS=Drosophila melanogaster OX=7227 GN=Sik2 PE=2 SV=1
13	PDB:5dykA	0.205	0.328	3.189E-23	809	0.077	0.125	5dykA.pdb.gz
14	PDB:6pjxA	0.228	0.530	3.523E-23	543	0.099	0.239	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.
15	PDB:3c4wB	0.213	0.513	8.214E-23	519	0.093	0.235	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
16	AFDB:A0A0G2JTD8	0.198	0.369	2.282E-22	688	0.107	0.203	A0A0G2JTD8.pdb.gz	A0A0G2JTD8_RAT Microtubule affinity regulating kinase 4 OS=Rattus norvegicus OX=10116 GN=Mark4 PE=4 SV=2
17	PDB:3pvuA	0.209	0.431	2.852E-22	609	0.095	0.204	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
18	PDB:4mk0A	0.202	0.408	3.151E-22	631	0.086	0.179	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
19	PDB:3nynA	0.214	0.497	6.650E-22	554	0.095	0.224	3nynA.pdb.gz	Molecular basis for activation of G protein-coupled receptor kinases.
20	PDB:6s9wA	0.200	0.596	1.270E-21	411	0.088	0.280	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60307	0.0	2641	1309	1.000	1.000	MAST3_HUMAN Microtubule-associated serine/threonine-protein kinase 3 OS=Homo sapiens OX=9606 GN=MAST3 PE=1 SV=2
2	Q6P0Q8	0.0	1372	1798	0.608	0.443	MAST2_HUMAN Microtubule-associated serine/threonine-protein kinase 2 OS=Homo sapiens OX=9606 GN=MAST2 PE=1 SV=2
3	Q9R1L5	0.0	1089	1570	0.404	0.337	MAST1_MOUSE Microtubule-associated serine/threonine-protein kinase 1 OS=Mus musculus OX=10090 GN=Mast1 PE=1 SV=3
4	Q9Y2H9	0.0	1338	1570	0.611	0.510	MAST1_HUMAN Microtubule-associated serine/threonine-protein kinase 1 OS=Homo sapiens OX=9606 GN=MAST1 PE=1 SV=2
5	Q9VUQ9	3.12e-164	543	2139	0.183	0.112	Q9VUQ9_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=dop PE=1 SV=1
6	Q9LE81	6.19e-91	322	1168	0.142	0.159	IRE_ARATH Probable serine/threonine protein kinase IRE OS=Arabidopsis thaliana OX=3702 GN=IRE PE=2 SV=1
7	F4HYG2	1.12e-86	310	1235	0.125	0.133	IRE3_ARATH Probable serine/threonine protein kinase IRE3 OS=Arabidopsis thaliana OX=3702 GN=IRE3 PE=2 SV=1
8	F4J6F6	1.22e-86	311	1296	0.136	0.137	IREH1_ARATH Probable serine/threonine protein kinase IREH1 OS=Arabidopsis thaliana OX=3702 GN=IREH1 PE=1 SV=1
9	Q60592	1.41e-81	298	1734	0.188	0.142	MAST2_MOUSE Microtubule-associated serine/threonine-protein kinase 2 OS=Mus musculus OX=10090 GN=Mast2 PE=1 SV=1
10	Q8I4W3	1.47e-69	251	735	0.095	0.169	Q8I4W3_PLAF7 RAC-beta serine/threonine protein kinase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1246900 PE=4 SV=1
11	Q9LW66	3.20e-69	246	568	0.105	0.241	Q9LW66_ARATH AGC (cAMP-dependent, cGMP-dependent and protein kinase C) kinase family protein OS=Arabidopsis thaliana OX=3702 GN=At3g23310 PE=1 SV=1
12	Q8L7S7	7.68e-68	241	551	0.103	0.245	Q8L7S7_ARATH AGC (cAMP-dependent, cGMP-dependent and protein kinase C) kinase family protein OS=Arabidopsis thaliana OX=3702 GN=DL3215C PE=1 SV=1
13	P47197	1.56e-67	238	481	0.104	0.283	AKT2_RAT RAC-beta serine/threonine-protein kinase OS=Rattus norvegicus OX=10116 GN=Akt2 PE=1 SV=1
14	Q8BYR2	1.81e-67	251	1129	0.114	0.132	LATS1_MOUSE Serine/threonine-protein kinase LATS1 OS=Mus musculus OX=10090 GN=Lats1 PE=1 SV=3
15	A4GW50	2.01e-67	237	464	0.098	0.276	A4GW50_RAT Serine/threonine kinase 38 like OS=Rattus norvegicus OX=10116 GN=Stk38l PE=1 SV=1
16	Q8UUX0	2.02e-67	238	479	0.105	0.286	Q8UUX0_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=cb945 PE=1 SV=1
17	Q7TSE6	3.32e-67	237	464	0.098	0.276	ST38L_MOUSE Serine/threonine-protein kinase 38-like OS=Mus musculus OX=10090 GN=Stk38l PE=1 SV=2
18	Q5RIL6	5.66e-67	249	1068	0.106	0.130	Q5RIL6_DANRE LATS, large tumor suppressor, homolog 1 (Drosophila) OS=Danio rerio OX=7955 GN=Lats PE=2 SV=1
19	Q5AP53	5.76e-67	243	732	0.095	0.171	CBK1_CANAL Serine/threonine-protein kinase CBK1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CBK1 PE=1 SV=2
20	O13310	6.28e-67	236	469	0.103	0.288	ORB6_SCHPO Serine/threonine-protein kinase orb6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=orb6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.8	20.3	ABC1 atypical kinase-like domain
2	PF16840 ACTL7A_N	2.6e+02	13.1	Actin-like protein 7A N-terminus
3	PF01636 APH	1.3	20.4	Phosphotransferase enzyme family
4	PF08926 DUF1908	9.4e-126	430.2	Domain of unknown function (DUF1908)
5	PF12330 Haspin_kinase	7e+02	10.5	Haspin like kinase domain
6	PF14531 Kinase-like	1.4	19.8	Kinase-like
7	PF00595 PDZ	1.9e-05	36.3	PDZ domain
8	PF13180 PDZ_2	0.011	27.4	PDZ domain
9	PF17820 PDZ_6	2.9e-07	41.6	PDZ domain
10	PF02163 Peptidase_M50	0.005	27.7	Peptidase family M50
11	PF00069 Pkinase	4.6e-58	208.3	Protein kinase domain
12	PF07714 PK_Tyr_Ser-Thr	3.2e-24	97.2	Protein tyrosine and serine/threonine kinase
13	PF01163 RIO1	1.6e+02	13.3	RIO1 family
14	PF14685 Tricorn_PDZ	48	15.3	Tricorn protease PDZ domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262811

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000385727	0.797	Microtubule associated serine/threonine kinase family member 4
2	9606.ENSP00000304604	0.769	Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3
3	9606.ENSP00000361021	0.763	Phosphatase and tensin homolog
4	9606.ENSP00000455625	0.756	cAMP-regulated phosphoprotein 19
5	9606.ENSP00000358644	0.711	Protein FAM19A3
6	9606.ENSP00000362170	0.694	Nuclear apoptosis-inducing factor 1
7	9606.ENSP00000262962	0.660	Part of the spliceosome which catalyzes two sequential transesterification reactions, first the excision of the non-coding intron from pre-mRNA and then the ligation of the coding exons to form the mature mRNA . Plays a role in stabilizing the structure of the spliceosome catalytic core and docking of the branch helix into the active site, producing 5'-exon and lariat intron-3'- intermediates (By similarity). May protect cells from TP53-dependent apoptosis upon dsDNA break damage through association with PRP19-CD5L complex
8	9606.ENSP00000306335	0.640	DNA-binding protein RFX2
9	9606.ENSP00000268695	0.636	N-acetylgalactosamine-6-sulfatase
10	9606.ENSP00000341743	0.631	Alpha-endosulfine
11	9606.ENSP00000298125	0.630	WD repeat and FYVE domain-containing protein 2
12	9606.ENSP00000347324	0.615	Methionine-R-sulfoxide reductase B3
13	9606.ENSP00000423630	0.611	F-box/LRR-repeat protein 7
14	9606.ENSP00000285873	0.602	Gem-associated protein 5
15	9606.ENSP00000291442	0.550	Nuclear receptor subfamily 2 group F member 6
16	9606.ENSP00000263390	0.523	Mediator of RNA polymerase II transcription subunit 26
17	9606.ENSP00000356708	0.514	Oligodendrocyte transcription factor 3
18	9606.ENSP00000330200	0.511	Butyrophilin-like protein 9
19	9606.ENSP00000235345	0.507	UDP-glucuronic acid/UDP-N-acetylgalactosamine transporter
20	9606.ENSP00000360034	0.505	Plasminogen activator inhibitor 1 RNA-binding protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.938	catalytic activity
GO:0140096	0.931	catalytic activity, acting on a protein
GO:0016301	0.929	kinase activity
GO:0004672	0.924	protein kinase activity
GO:0004674	0.822	protein serine/threonine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.970	cellular process
GO:0032501	0.953	multicellular organismal process
GO:0050789	0.846	regulation of biological process
GO:0032502	0.782	developmental process
GO:0008152	0.665	metabolic process
GO:0071704	0.656	organic substance metabolic process
GO:0050794	0.655	regulation of cellular process
GO:0048856	0.654	anatomical structure development
GO:0044238	0.647	primary metabolic process
GO:0006807	0.629	nitrogen compound metabolic process
GO:0044237	0.619	cellular metabolic process
GO:0043170	0.585	macromolecule metabolic process
GO:0007275	0.518	multicellular organism development
GO:0007399	0.491	nervous system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	0.995	intracellular anatomical structure
GO:0043229	0.966	intracellular organelle
GO:0005737	0.948	cytoplasm
GO:0016020	0.919	membrane
GO:0043231	0.848	intracellular membrane-bounded organelle
GO:0005634	0.772	nucleus
GO:0005829	0.611	cytosol
GO:0071944	0.431	cell periphery
GO:0005886	0.415	plasma membrane
GO:0042995	0.398	cell projection
GO:0120025	0.387	plasma membrane bounded cell projection
GO:0043005	0.380	neuron projection
GO:0036477	0.328	somatodendritic compartment

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.-.-	0.929	Transferring phosphorus-containing groups.
EC:2.7.1.-	0.924	Phosphotransferases with an alcohol group as acceptor.

[back to server]