StarFunc result for job id O60309

User Input

>input (1634 residues)
MTSAQCPALACVMSPLRFWGPWPLLMWQLLWLLVKEAQPLEWVKDPLQLTSNPLGPPEPW
SSHSSHFPRESPHAPTLPADPWDFDHLGPSASSEMPAPPQESTENLVPFLDTWDSAGELP
LEPEQFLASQQDLKDKLSPQERLPVSPKKLKKDPAQRWSLAEIIGIIHQLSTPQSQKQTL
QNEYSSTDTPYPGSLPPELRVKSDEPPGPSEQVGPSQFHLEPETQNPETLEDIQSSSLQQ
EAPAQLPQLLEEEPSSMQQEAPALPPESSMESLTLPNHEVSVQPPGEDQAYYHLPNITVK
PADVEVTITSEPTNETESSQAQQETPIQFPEEVEPSATQQEAPIEPPVPPMEHELSISEQ
QQPVQPSESSREVESSPTQQETPGQPPEHHEVTVSPPGHHQTHHLASPSVSVKPPDVQLT
IAAEPSAEVGTSLVHQEATTRLSGSGNDVEPPAIQHGGPPLLPESSEEAGPLAVQQETSF
QSPEPINNENPSPTQQEAAAEHPQTAEEGESSLTHQEAPAQTPEFPNVVVAQPPEHSHLT
QATVQPLDLGFTITPESMTEVELSPTMKETPTQPPKKVVPQLRVYQGVTNPTPGQDQAQH
PVSPSVTVQLLDLGLTITPEPTTEVGHSTPPKRTIVSPKHPEVTLPHPDQVQTQHSHLTR
ATVQPLDLGFTITPKSMTEVEPSTALMTTAPPPGHPEVTLPPSDKGQAQHSHLTQATVQP
LDLELTITTKPTTEVKPSPTTEETSTQLPDLGLAIIPEPTTETGHSTALEKTTAPRPDRV
QTLHRSLTEVTGPPTELEPAQDSLVQSESYTQNKALTAPEEHKASTSTNICELCTCGDEM
LSCIDLNPEQRLRQVPVPEPNTHNGTFTILNFQGNYISYIDGNVWKAYSWTEKLILRENN
LTELHKDSFEGLLSLQYLDLSCNKIQSIERHTFEPLPFLKFINLSCNVITELSFGTFQAW
HGMQFLHKLILNHNPLTTVEDPYLFKLPALKYLDMGTTLVPLTTLKNILMMTVELEKLIV
PSHMACCLCQFKNSIEAVCKTVKLHCNSACLTNTTHCPEEASVGNPEGAFMKVLQARKNY
TSTELIIEPEEPSDSSGINLSGFGSEQLDTNDESDVTSTLSYILPYFSAVNLDVKSLLLP
FIKLPTTGNSLAKIQTVGKNRQRLNRVLMGPRSIQKRHFKEVGRQSIRREQGAQASVENT
AEEKRLGSPAPRELKQPHTQQGPEKLAGNAVYTKPSFTQEHKAAVSVLKPFSKGAPSTSS
PAKALPQVRDRWKDLTHAISILESAKARVTNMKTSKPIVHSRKKYRFHKTRSRMTHRTPK
VKKSPKVRKKSYLSRLMLSNRLPFSAAKSLINSPSQGAFSSLRDLSPQENPFLEVSAPSE
HFIENNNTKDTTARNAFEENVFMENTNMPEGTISENTNYNHPPEADSAGTAFNLGPTVKQ
TETKWEYNNVGTDLSPEPKSFNYPLLSSPGDQFEIQLTQQLQSVIPNNNVRRLIAHVIRT
LKMDCSGAHVQVTCAKLVSRTGHLMKLLSGQQEVKASKIEWDTDQWKTENYINESTEAQS
EQKEKSLEFTKELPGYGYTKKLILALIVTGILTILIILLCLIEICCHRRSLQEDEEGFSR
DSEAPTEEESEALP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q95TJ2	0.048	0.059	6.968E-10	1261	0.134	0.174	Q95TJ2.pdb.gz	Q95TJ2_DROME LP06813p OS=Drosophila melanogaster OX=7227 GN=Sdb PE=2 SV=1
2	PDB:6gffI	0.082	0.204	3.008E-7	551	0.037	0.111	6gffI.pdb.gz
3	PDB:1xcdA	0.091	0.371	4.616E-7	305	0.031	0.167	1xcdA.pdb.gz
4	PDB:2ft3F	0.076	0.255	7.083E-7	305	0.029	0.157	2ft3F.pdb.gz
5	PDB:7wv3A	0.085	0.193	1.228E-6	668	0.023	0.055	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
6	AFDB:Q8IQT4	0.039	0.031	4.667E-6	2133	0.143	0.110	Q8IQT4.pdb.gz	Q8IQT4_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Nirvana PE=1 SV=1
7	PDB:6hkwA	0.079	0.373	9.833E-6	306	0.025	0.134	6hkwA.pdb.gz
8	PDB:7wrqA	0.082	0.224	1.509E-5	566	0.026	0.074	7wrqA.pdb.gz
9	PDB:5y31B	0.075	0.228	2.049E-5	511	0.022	0.070	5y31B.pdb.gz	Structural basis of epilepsy-related ligand-receptor complex LGI1-ADAM22.
10	AFDB:F1RCL8	0.035	0.034	2.588E-5	1796	0.146	0.133	F1RCL8.pdb.gz	F1RCL8_DANRE BCL-6 corepressor isoform X1 OS=Danio rerio OX=7955 GN=bcor PE=1 SV=1
11	PDB:7tvfD	0.091	0.279	3.553E-5	515	0.026	0.083	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
12	PDB:3t6qA	0.072	0.163	3.777E-5	601	0.022	0.060	3t6qA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
13	PDB:7p5vB	0.082	0.178	3.777E-5	732	0.022	0.049	7p5vB.pdb.gz
14	AFDB:X2JEI9	0.049	0.041	9.941E-5	2206	0.127	0.094	X2JEI9.pdb.gz	X2JEI9_DROME Rho GTPase activating protein at 19D, isoform D OS=Drosophila melanogaster OX=7227 GN=RhoGAP19D PE=1 SV=1
15	AFDB:Q5T5U3	0.040	0.036	1.525E-4	1958	0.133	0.111	Q5T5U3.pdb.gz	RHG21_HUMAN Rho GTPase-activating protein 21 OS=Homo sapiens OX=9606 GN=ARHGAP21 PE=1 SV=2
16	AFDB:Q6DFV3	0.042	0.038	4.316E-4	1944	0.130	0.109	Q6DFV3.pdb.gz	RHG21_MOUSE Rho GTPase-activating protein 21 OS=Mus musculus OX=10090 GN=Arhgap21 PE=1 SV=2
17	AFDB:Q9C105	0.058	0.070	4.316E-4	1236	0.083	0.109	Q9C105.pdb.gz	YKT4_SCHPO Chitinase-like protein PB1E7.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAPB1E7.04c PE=3 SV=1
18	AFDB:Q8CGM2	0.040	0.036	8.459E-4	1859	0.122	0.107	Q8CGM2.pdb.gz	RP1L1_MOUSE Retinitis pigmentosa 1-like 1 protein OS=Mus musculus OX=10090 GN=Rp1l1 PE=1 SV=1
19	AFDB:Q8NFU7	0.041	0.035	9.560E-4	2136	0.143	0.109	Q8NFU7.pdb.gz	TET1_HUMAN Methylcytosine dioxygenase TET1 OS=Homo sapiens OX=9606 GN=TET1 PE=1 SV=2
20	AFDB:O76894	0.031	0.030	1.016E-3	1795	0.141	0.129	O76894.pdb.gz	O76894_DROME EG:56G7.1 protein OS=Drosophila melanogaster OX=7227 GN=Mur2B PE=4 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IW52	1.36e-09	65.5	837	0.031	0.060	SLIK4_HUMAN SLIT and NTRK-like protein 4 OS=Homo sapiens OX=9606 GN=SLITRK4 PE=1 SV=1
2	Q810B8	1.62e-09	65.5	837	0.031	0.060	SLIK4_MOUSE SLIT and NTRK-like protein 4 OS=Mus musculus OX=10090 GN=Slitrk4 PE=1 SV=2
3	Q80ZD9	1.98e-09	64.7	519	0.035	0.112	AMGO2_MOUSE Amphoterin-induced protein 2 OS=Mus musculus OX=10090 GN=Amigo2 PE=1 SV=1
4	Q9U3A0	5.89e-09	63.2	594	0.031	0.084	PAN1_CAEEL P-granule-associated novel protein 1 OS=Caenorhabditis elegans OX=6239 GN=pan-1 PE=1 SV=1
5	D3ZK41	1.48e-08	62.0	846	0.041	0.079	D3ZK41_RAT SLIT and NTRK-like family, member 2 OS=Rattus norvegicus OX=10116 GN=Slitrk2 PE=4 SV=2
6	Q810C0	1.68e-08	62.0	846	0.041	0.079	SLIK2_MOUSE SLIT and NTRK-like protein 2 OS=Mus musculus OX=10090 GN=Slitrk2 PE=1 SV=1
7	Q7M6Z0	1.77e-08	61.2	420	0.028	0.107	R4RL2_MOUSE Reticulon-4 receptor-like 2 OS=Mus musculus OX=10090 GN=Rtn4rl2 PE=1 SV=1
8	Q80WD1	2.11e-08	60.8	420	0.028	0.107	R4RL2_RAT Reticulon-4 receptor-like 2 OS=Rattus norvegicus OX=10116 GN=Rtn4rl2 PE=1 SV=1
9	Q9H156	3.81e-08	60.8	845	0.040	0.078	SLIK2_HUMAN SLIT and NTRK-like protein 2 OS=Homo sapiens OX=9606 GN=SLITRK2 PE=1 SV=1
10	Q91ZV8	4.25e-08	60.8	1336	0.026	0.032	AGRA2_MOUSE Adhesion G protein-coupled receptor A2 OS=Mus musculus OX=10090 GN=Adgra2 PE=1 SV=2
11	Q96PE1	4.47e-08	60.8	1338	0.030	0.037	AGRA2_HUMAN Adhesion G protein-coupled receptor A2 OS=Homo sapiens OX=9606 GN=ADGRA2 PE=1 SV=2
12	Q6WRH9	5.97e-08	60.5	2597	0.031	0.019	IGS10_RAT Immunoglobulin superfamily member 10 OS=Rattus norvegicus OX=10116 GN=Igsf10 PE=1 SV=1
13	Q3V1M1	6.12e-08	60.5	2594	0.031	0.019	IGS10_MOUSE Immunoglobulin superfamily member 10 OS=Mus musculus OX=10090 GN=Igsf10 PE=2 SV=2
14	Q5U1A7	1.04e-07	59.3	738	0.024	0.054	Q5U1A7_DROME Fish-lips, isoform C OS=Drosophila melanogaster OX=7227 GN=Fili PE=2 SV=1
15	Q52KR2	1.77e-07	58.9	1054	0.028	0.043	LRIG2_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 2 OS=Mus musculus OX=10090 GN=Lrig2 PE=1 SV=1
16	Q7L0X0	3.29e-07	57.8	811	0.031	0.063	TRIL_HUMAN TLR4 interactor with leucine rich repeats OS=Homo sapiens OX=9606 GN=TRIL PE=1 SV=2
17	W8W3S0	5.18e-07	57.4	1027	0.026	0.041	W8W3S0_SALSA TLR20a protein OS=Salmo salar OX=8030 GN=TLR PE=2 SV=1
18	Q810B7	5.61e-07	57.0	957	0.029	0.049	SLIK5_MOUSE SLIT and NTRK-like protein 5 OS=Mus musculus OX=10090 GN=Slitrk5 PE=2 SV=1
19	B8JKM0	6.12e-07	56.6	524	0.031	0.097	B8JKM0_DANRE Leucine-rich repeat transmembrane neuronal 1 OS=Danio rerio OX=7955 GN=lrrtm1 PE=1 SV=1
20	Q6R6I6	6.88e-07	56.6	758	0.032	0.069	RXFP1_RAT Relaxin receptor 1 OS=Rattus norvegicus OX=10116 GN=Rxfp1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06365 CD34_antigen	1.3	20.1	CD34/Podocalyxin family
2	PF15779 LRRC37	3.8e-87	298.0	Leucine-rich repeat-containing protein 37 family
3	PF14914 LRRC37AB_C	8.8e-69	241.6	LRRC37A/B like protein 1 C-terminal domain
4	PF12799 LRR_4	2.9e-05	35.5	Leucine Rich repeats (2 copies)
5	PF13306 LRR_5	13	17.2	BspA type Leucine rich repeat region (6 copies)
6	PF13516 LRR_6	5.3e+02	12.2	Leucine Rich repeat
7	PF13855 LRR_8	1.2e-14	65.1	Leucine rich repeat
8	PF14580 LRR_9	1.4e+02	13.4	Leucine-rich repeat
9	PF05510 Sarcoglycan_2	81	13.4	Sarcoglycan alpha/epsilon
10	PF15102 TMEM154	1.1e+02	14.0	TMEM154 protein family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000464535

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000485398	0.656	speedy/RINGO cell cycle regulator family member E5
2	9606.ENSP00000262419	0.652	KAT8 regulatory NSL complex subunit 1
3	9606.ENSP00000337478	0.645	ADP ribosylation factor like GTPase 17A
4	9606.ENSP00000404247	0.637	ADP-ribosylation factor-like protein 17
5	9606.ENSP00000386230	0.558	Putative uncharacterized protein C19orf73

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.987	biological regulation
GO:0050789	0.983	regulation of biological process
GO:0009987	0.978	cellular process
GO:0050794	0.966	regulation of cellular process
GO:0032501	0.524	multicellular organismal process
GO:0050896	0.493	response to stimulus
GO:0048518	0.399	positive regulation of biological process
GO:0019222	0.393	regulation of metabolic process
GO:0060255	0.367	regulation of macromolecule metabolic process
GO:0080090	0.324	regulation of primary metabolic process
GO:0048522	0.302	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0070013	0.992	intracellular organelle lumen
GO:0005737	0.981	cytoplasm
GO:0012505	0.980	endomembrane system
GO:0071944	0.893	cell periphery
GO:0005794	0.805	Golgi apparatus
GO:0016020	0.747	membrane
GO:0005886	0.519	plasma membrane
GO:0005788	0.347	endoplasmic reticulum lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]