StarFunc result for job id O60312

User Input

>input (1499 residues)
MEREPAGTEEPGPPGRRRRREGRTRTVRSNLLPPPGAEDPAAGAAKGERRRRRGCAQHLA
DNRLKTTKYTLLSFLPKNLFEQFHRPANVYFVFIALLNFVPAVNAFQPGLALAPVLFILA
ITAFRDLWEDYSRHRSDHKINHLGCLVFSREEKKYVNRFWKEIHVGDFVRLRCNEIFPAD
ILLLSSSDPDGLCHIETANLDGETNLKRRQVVRGFSELVSEFNPLTFTSVIECEKPNNDL
SRFRGCIIHDNGKKAGLYKENLLLRGCTLRNTDAVVGIVIYAGHETKALLNNSGPRYKRS
KLERQMNCDVLWCVLLLVCMSLFSAVGHGLWIWRYQEKKSLFYVPKSDGSSLSPVTAAVY
SFLTMIIVLQVLIPISLYVSIEIVKACQVYFINQDMQLYDEETDSQLQCRALNITEDLGQ
IQYIFSDKTGTLTENKMVFRRCTVSGVEYSHDANAQRLARYQEADSEEEEVVPRGGSVSQ
RGSIGSHQSVRVVHRTQSTKSHRRTGSRAEAKRASMLSKHTAFSSPMEKDITPDPKLLEK
VSECDKSLAVARHQEHLLAHLSPELSDVFDFFIALTICNTVVVTSPDQPRTKVRVRFELK
SPVKTIEDFLRRFTPSCLTSGCSSIGSLAANKSSHKLGSSFPSTPSSDGMLLRLEERLGQ
PTSAIASNGYSSQADNWASELAQEQESERELRYEAESPDEAALVYAARAYNCVLVERLHD
QVSVELPHLGRLTFELLHTLGFDSVRKRMSVVIRHPLTDEINVYTKGADSVVMDLLQPCS
SVDARGRHQKKIRSKTQNYLNVYAAEGLRTLCIAKRVLSKEEYACWLQSHLEAESSLENS
EELLFQSAIRLETNLHLLGATGIEDRLQDGVPETISKLRQAGLQIWVLTGDKQETAVNIA
YACKLLDHDEEVITLNATSQEACAALLDQCLCYVQSRGLQRAPEKTKGKVSMRFSSLCPP
STSTASGRRPSLVIDGRSLAYALEKNLEDKFLFLAKQCRSVLCCRSTPLQKSMVVKLVRS
KLKAMTLAIGDGANDVSMIQVADVGVGISGQEGMQAVMASDFAVPKFRYLERLLILHGHW
CYSRLANMVLYFFYKNTMFVGLLFWFQFFCGFSASTMIDQWYLIFFNLLFSSLPPLVTGV
LDRDVPANVLLTNPQLYKSGQNMEEYRPRTFWFNMADAAFQSLVCFSIPYLAYYDSNVDL
FTWGTPIVTIALLTFLLHLGIETKTWTWLNWITCGFSVLLFFTVALIYNASCATCYPPSN
PYWTMQALLGDPVFYLTCLMTPVAALLPRLFFRSLQGRVFPTQLQLARQLTRKSPRRCSA
PKETFAQGRLPKDSGTEHSSGRTVKTSVPLSQPSWHTQQPVCSLEASGEPSTVDMSMPVR
EHTLLEGLSAPAPMSSAPGEAVLRSPGGCPEESKVRAASTGRVTPLSSLFSLPTFSLLNW
ISSWSLVSRLGSVLQFSRTEQLADGQAGRGLPVQPHSGRSGLQGPDHRLLIGASSRRSQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O18182	0.679	0.720	0.000	1411	0.359	0.381	O18182.pdb.gz	O18182_CAEEL Phospholipid-transporting ATPase OS=Caenorhabditis elegans OX=6239 GN=tat-3 PE=1 SV=3
2	AFDB:O60312	1.000	1.000	0.000	1499	1.000	1.000	O60312.pdb.gz	AT10A_HUMAN Phospholipid-transporting ATPase VA OS=Homo sapiens OX=9606 GN=ATP10A PE=1 SV=2
3	AFDB:Q7KTG6	0.676	0.668	0.000	1517	0.368	0.363	Q7KTG6.pdb.gz	Q7KTG6_DROME Phospholipid-transporting ATPase OS=Drosophila melanogaster OX=7227 GN=CG18419 PE=3 SV=1
4	AFDB:Q8K2X1	0.727	0.768	0.000	1416	0.472	0.499	Q8K2X1.pdb.gz	AT10D_MOUSE Phospholipid-transporting ATPase VD OS=Mus musculus OX=10090 GN=Atp10d PE=1 SV=2
5	AFDB:Q9P241	0.739	0.776	0.000	1426	0.472	0.496	Q9P241.pdb.gz	AT10D_HUMAN Phospholipid-transporting ATPase VD OS=Homo sapiens OX=9606 GN=ATP10D PE=1 SV=3
6	AFDB:F4IE35	0.673	0.845	2.084E-91	1185	0.282	0.356	F4IE35.pdb.gz	F4IE35_ARATH Phospholipid-transporting ATPase OS=Arabidopsis thaliana OX=3702 GN=At1g26130 PE=1 SV=1
7	AFDB:Q9SGG3	0.626	0.756	5.581E-91	1228	0.280	0.342	Q9SGG3.pdb.gz	ALA5_ARATH Probable phospholipid-transporting ATPase 5 OS=Arabidopsis thaliana OX=3702 GN=ALA5 PE=3 SV=1
8	AFDB:Q7JPE3	0.639	0.782	1.195E-90	1212	0.273	0.337	Q7JPE3.pdb.gz	Q7JPE3_CAEEL Phospholipid-transporting ATPase OS=Caenorhabditis elegans OX=6239 GN=tat-4 PE=1 SV=1
9	AFDB:Q9LNQ4	0.630	0.767	1.250E-90	1216	0.277	0.341	Q9LNQ4.pdb.gz	ALA4_ARATH Probable phospholipid-transporting ATPase 4 OS=Arabidopsis thaliana OX=3702 GN=ALA4 PE=3 SV=2
10	AFDB:Q9SX33	0.631	0.778	2.747E-89	1200	0.282	0.352	Q9SX33.pdb.gz	ALA9_ARATH Putative phospholipid-transporting ATPase 9 OS=Arabidopsis thaliana OX=3702 GN=ALA9 PE=3 SV=1
11	PDB:7kycA	0.625	0.782	7.153E-83	1178	0.284	0.361	7kycA.pdb.gz	Transport mechanism of P4 ATPase phosphatidylcholine flippases.
12	PDB:7py4A	0.597	0.789	5.915E-80	1112	0.275	0.371	7py4A.pdb.gz	Autoinhibition and regulation by phosphoinositides of ATP8B1, a human lipid flippase associated with intrahepatic cholestatic disorders.
13	PDB:7kyaA	0.627	0.787	4.438E-79	1174	0.274	0.350	7kyaA.pdb.gz	Transport mechanism of P4 ATPase phosphatidylcholine flippases.
14	PDB:7vghB	0.607	0.757	1.487E-78	1183	0.278	0.352	7vghB.pdb.gz	Structural insights into the activation of autoinhibited human lipid flippase ATP8B1 upon substrate binding.
15	PDB:6rohA	0.615	0.815	4.765E-78	1112	0.257	0.346	6rohA.pdb.gz	Structure and autoregulation of a P4-ATPase lipid flippase.
16	PDB:6k7lA	0.574	0.848	8.566E-71	992	0.257	0.388	6k7lA.pdb.gz	Cryo-EM structures capture the transport cycle of the P4-ATPase flippase.
17	PDB:7bspA	0.575	0.812	2.665E-66	1028	0.238	0.347	7bspA.pdb.gz	Transport Cycle of Plasma Membrane Flippase ATP11C by Cryo-EM.
18	PDB:6lknA	0.572	0.782	3.513E-64	1064	0.243	0.343	6lknA.pdb.gz	Crystal structure of a human plasma membrane phospholipid flippase.
19	PDB:7rd6A	0.539	0.841	2.008E-58	929	0.184	0.297	7rd6A.pdb.gz	Structural basis of the P4B ATPase lipid flippase activity.
20	PDB:7bssA	0.471	0.835	6.159E-46	816	0.190	0.349	7bssA.pdb.gz	Transport Cycle of Plasma Membrane Flippase ATP11C by Cryo-EM.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60312	0.0	3105	1499	1.000	1.000	AT10A_HUMAN Phospholipid-transporting ATPase VA OS=Homo sapiens OX=9606 GN=ATP10A PE=1 SV=2
2	O94823	0.0	1294	1461	0.451	0.463	AT10B_HUMAN Phospholipid-transporting ATPase VB OS=Homo sapiens OX=9606 GN=ATP10B PE=1 SV=2
3	Q8K2X1	0.0	1374	1416	0.478	0.506	AT10D_MOUSE Phospholipid-transporting ATPase VD OS=Mus musculus OX=10090 GN=Atp10d PE=1 SV=2
4	Q9P241	0.0	1381	1426	0.470	0.494	AT10D_HUMAN Phospholipid-transporting ATPase VD OS=Homo sapiens OX=9606 GN=ATP10D PE=1 SV=3
5	Q7KTG5	3.32e-177	572	1494	0.199	0.199	Q7KTG5_DROME Phospholipid-transporting ATPase OS=Drosophila melanogaster OX=7227 GN=DmCG33298 PE=3 SV=1
6	Q7KTG6	1.64e-175	568	1517	0.195	0.192	Q7KTG6_DROME Phospholipid-transporting ATPase OS=Drosophila melanogaster OX=7227 GN=CG18419 PE=3 SV=1
7	Q95S66	1.90e-166	515	585	0.175	0.450	Q95S66_DROME Phospholipid-transporting ATPase OS=Drosophila melanogaster OX=7227 GN=CG18419 PE=2 SV=1
8	O18182	2.26e-155	511	1411	0.210	0.223	O18182_CAEEL Phospholipid-transporting ATPase OS=Caenorhabditis elegans OX=6239 GN=tat-3 PE=1 SV=3
9	Q5ASQ8	3.09e-134	454	1501	0.171	0.171	Q5ASQ8_EMENI Phospholipid-transporting ATPase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=AN8672.2 PE=3 SV=1
10	P98198	1.61e-132	443	1209	0.171	0.212	AT8B2_HUMAN Phospholipid-transporting ATPase ID OS=Homo sapiens OX=9606 GN=ATP8B2 PE=1 SV=2
11	A0A5K1VW70	1.99e-132	442	1190	0.171	0.215	A0A5K1VW70_HUMAN Phospholipid-transporting ATPase OS=Homo sapiens OX=9606 GN=ATP8B2 PE=1 SV=1
12	Q8TF62	1.21e-131	440	1192	0.167	0.210	AT8B4_HUMAN Probable phospholipid-transporting ATPase IM OS=Homo sapiens OX=9606 GN=ATP8B4 PE=1 SV=3
13	P98199	8.73e-131	438	1209	0.170	0.211	AT8B2_MOUSE Phospholipid-transporting ATPase ID OS=Mus musculus OX=10090 GN=Atp8b2 PE=1 SV=2
14	P98204	3.13e-129	433	1158	0.161	0.208	ALA1_ARATH Phospholipid-transporting ATPase 1 OS=Arabidopsis thaliana OX=3702 GN=ALA1 PE=2 SV=1
15	Q2KG18	4.94e-129	440	1524	0.187	0.184	Q2KG18_MAGO7 Phospholipid-transporting ATPase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=MGCH7_ch7g517 PE=3 SV=1
16	A0A0B4K756	6.83e-127	434	1533	0.169	0.165	A0A0B4K756_DROME Phospholipid-transporting ATPase OS=Drosophila melanogaster OX=7227 GN=ATP8B PE=3 SV=1
17	A0A0B4LH79	7.59e-127	432	1448	0.169	0.175	A0A0B4LH79_DROME Phospholipid-transporting ATPase OS=Drosophila melanogaster OX=7227 GN=ATP8B PE=3 SV=1
18	A0A0B4LH22	7.06e-126	427	1317	0.171	0.195	A0A0B4LH22_DROME Phospholipid-transporting ATPase OS=Drosophila melanogaster OX=7227 GN=ATP8B PE=3 SV=1
19	A0A0B4K638	8.25e-126	431	1547	0.171	0.166	A0A0B4K638_DROME Phospholipid-transporting ATPase OS=Drosophila melanogaster OX=7227 GN=ATP8B PE=3 SV=1
20	A0A0B4LH21	1.17e-125	429	1462	0.171	0.176	A0A0B4LH21_DROME Phospholipid-transporting ATPase OS=Drosophila melanogaster OX=7227 GN=ATP8B PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13246 Cation_ATPase	4.9e-05	34.6	Cation transport ATPase (P-type)
2	PF00122 E1-E2_ATPase	0.75	20.8	E1-E2 ATPase
3	PF00702 Hydrolase	1.8e-09	49.7	haloacid dehalogenase-like hydrolase
4	PF08282 Hydrolase_3	2	19.7	haloacid dehalogenase-like hydrolase
5	PF16212 PhoLip_ATPase_C	3.9e-73	257.9	Phospholipid-translocating P-type ATPase C-terminal
6	PF16209 PhoLip_ATPase_N	6e-17	72.4	Phospholipid-translocating ATPase N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000349325

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000230461	0.913	Cell cycle control protein 50A
2	9606.ENSP00000433433	0.804	MAGE-like protein 2
3	9606.ENSP00000232165	0.789	Ubiquitin-protein ligase E3A
4	9606.ENSP00000480316	0.765	Gamma-tubulin complex component 5
5	9606.ENSP00000382972	0.763	Small nuclear ribonucleoprotein-associated protein N
6	9606.ENSP00000313881	0.726	Probable E3 ubiquitin-protein ligase makorin-3
7	9606.ENSP00000332643	0.726	Necdin
8	9606.ENSP00000308725	0.720	Gamma-aminobutyric acid receptor subunit beta-3
9	9606.ENSP00000450842	0.706	Cell cycle control protein 50B
10	9606.ENSP00000397172	0.702	Bladder cancer-associated protein
11	9606.ENSP00000337618	0.700	Magnesium transporter NIPA2
12	9606.ENSP00000419663	0.697	Cell cycle control protein 50C
13	9606.ENSP00000377140	0.667	Cyclic nucleotide-gated cation channel alpha-3
14	9606.ENSP00000479113	0.658	Gamma-aminobutyric acid receptor subunit gamma-3
15	9606.ENSP00000337452	0.653	Magnesium transporter NIPA1
16	9606.ENSP00000293922	0.652	Pentraxin-4
17	9606.ENSP00000380877	0.652	Activating signal cointegrator 1 complex subunit 2
18	9606.ENSP00000262319	0.643	Telomere length regulation protein TEL2 homolog
19	9606.ENSP00000317257	0.643	Copine-1
20	9606.ENSP00000333735	0.643	Nuclear pore-associated protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0046624	1.000	sphingolipid transporter activity
GO:0008525	0.999	phosphatidylcholine transporter activity
GO:0140333	0.999	glycerophospholipid flippase activity
GO:0140345	0.582	phosphatidylcholine flippase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0065007	0.991	biological regulation
GO:0050794	0.982	regulation of cellular process
GO:0051179	0.906	localization
GO:0006810	0.895	transport
GO:0055085	0.886	transmembrane transport
GO:0006811	0.839	monoatomic ion transport
GO:0048518	0.784	positive regulation of biological process
GO:0034220	0.698	monoatomic ion transmembrane transport
GO:0048522	0.616	positive regulation of cellular process
GO:0051128	0.386	regulation of cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.999	endomembrane system
GO:0032991	0.996	protein-containing complex
GO:0005886	0.973	plasma membrane
GO:1990351	0.917	transporter complex
GO:0005783	0.896	endoplasmic reticulum
GO:1990531	0.882	phospholipid-translocating ATPase complex
GO:0043233	0.797	organelle lumen
GO:0070013	0.783	intracellular organelle lumen
GO:0005634	0.765	nucleus
GO:0031981	0.748	nuclear lumen
GO:0005654	0.699	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.6.2.1	1.000	P-type phospholipid transporter.

[back to server]