StarFunc result for job id O60313

User Input

>input (960 residues)
MWRLRRAAVACEVCQSLVKHSSGIKGSLPLQKLHLVSRSIYHSHHPTLKLQRPQLRTSFQ
QFSSLTNLPLRKLKFSPIKYGYQPRRNFWPARLATRLLKLRYLILGSAVGGGYTAKKTFD
QWKDMIPDLSEYKWIVPDIVWEIDEYIDFEKIRKALPSSEDLVKLAPDFDKIVESLSLLK
DFFTSGSPEETAFRATDRGSESDKHFRKVSDKEKIDQLQEELLHTQLKYQRILERLEKEN
KELRKLVLQKDDKGIHHRKLKKSLIDMYSEVLDVLSDYDASYNTQDHLPRVVVVGDQSAG
KTSVLEMIAQARIFPRGSGEMMTRSPVKVTLSEGPHHVALFKDSSREFDLTKEEDLAALR
HEIELRMRKNVKEGCTVSPETISLNVKGPGLQRMVLVDLPGVINTVTSGMAPDTKETIFS
ISKAYMQNPNAIILCIQDGSVDAERSIVTDLVSQMDPHGRRTIFVLTKVDLAEKNVASPS
RIQQIIEGKLFPMKALGYFAVVTGKGNSSESIEAIREYEEEFFQNSKLLKTSMLKAHQVT
TRNLSLAVSDCFWKMVRESVEQQADSFKATRFNLETEWKNNYPRLRELDRNELFEKAKNE
ILDEVISLSQVTPKHWEEILQQSLWERVSTHVIENIYLPAAQTMNSGTFNTTVDIKLKQW
TDKQLPNKAVEVAWETLQEEFSRFMTEPKGKEHDDIFDKLKEAVKEESIKRHKWNDFAED
SLRVIQHNALEDRSISDKQQWDAAIYFMEEALQARLKDTENAIENMVGPDWKKRWLYWKN
RTQEQCVHNETKNELEKMLKCNEEHPAYLASDEITTVRKNLESRGVEVDPSLIKDTWHQV
YRRHFLKTALNHCNLCRRGFYYYQRHFVDSELECNDVVLFWRIQRMLAITANTLRQQLTN
TEVRRLEKNVKEVLEDFAEDGEKKIKLLTGKRVQLAEDLKKVREIQEKLDAFIEALHQEK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E5KLJ9	0.795	0.781	0.000	979	0.960	0.942	E5KLJ9.pdb.gz	E5KLJ9_HUMAN Dynamin-like 120 kDa protein, mitochondrial OS=Homo sapiens OX=9606 GN=OPA1 PE=1 SV=1
2	AFDB:O93248	0.788	0.779	0.000	971	0.773	0.764	O93248.pdb.gz	OPA1_ONCMA Dynamin-like 120 kDa protein, mitochondrial OS=Oncorhynchus masou OX=8020 GN=opa1 PE=2 SV=1
3	AFDB:Q5U3A7	0.775	0.771	0.000	966	0.794	0.789	Q5U3A7.pdb.gz	OPA1_DANRE Dynamin-like 120 kDa protein, mitochondrial OS=Danio rerio OX=7955 GN=opa1 PE=2 SV=1
4	AFDB:Q18965	0.762	0.759	4.066E-80	964	0.499	0.497	Q18965.pdb.gz	Q18965_CAEEL Dynamin-like 120 kDa protein, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=eat-3 PE=1 SV=3
5	AFDB:P87320	0.537	0.568	9.910E-29	903	0.174	0.185	P87320.pdb.gz	MSP1_SCHPO Protein msp1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=msp1 PE=3 SV=2
6	AFDB:Q9WVP9	0.320	0.457	2.321E-23	655	0.130	0.191	Q9WVP9.pdb.gz	MX2_MOUSE Interferon-induced GTP-binding protein Mx2 OS=Mus musculus OX=10090 GN=Mx2 PE=2 SV=2
7	AFDB:P09922	0.326	0.485	2.897E-23	631	0.135	0.206	P09922.pdb.gz	MX1B_MOUSE Interferon-induced GTP-binding protein Mx1 OS=Mus musculus OX=10090 GN=Mx1 PE=1 SV=1
8	AFDB:Q9U1M9	0.330	0.344	4.931E-23	920	0.168	0.175	Q9U1M9.pdb.gz	DYNB_DICDI Dynamin-B OS=Dictyostelium discoideum OX=44689 GN=dymB PE=3 SV=1
9	AFDB:Q9FNX5	0.352	0.523	6.154E-23	624	0.135	0.208	Q9FNX5.pdb.gz	DRP1E_ARATH Phragmoplastin DRP1E OS=Arabidopsis thaliana OX=3702 GN=DRP1E PE=1 SV=1
10	AFDB:Q9N0Y2	0.328	0.434	1.705E-22	711	0.157	0.212	Q9N0Y2.pdb.gz	MX2_CANLF Interferon-induced GTP-binding protein Mx2 OS=Canis lupus familiaris OX=9615 GN=MX2 PE=2 SV=1
11	PDB:5wp9A	0.251	0.393	1.042E-17	590	0.135	0.220	5wp9A.pdb.gz	Structural basis of mitochondrial receptor binding and constriction by DRP1.
12	PDB:7ax3A	0.264	0.412	1.090E-17	587	0.126	0.206	7ax3A.pdb.gz	CryoEM structure of the super-constricted two-start dynamin 1 filament.
13	PDB:5gtmB	0.270	0.464	2.222E-15	522	0.108	0.199	5gtmB.pdb.gz
14	PDB:3szrA	0.295	0.479	3.789E-14	559	0.115	0.197	3szrA.pdb.gz
15	PDB:2j68A	0.172	0.229	2.459E-8	680	0.104	0.147	2j68A.pdb.gz	A Bacterial Dynamin-Like Protein
16	PDB:4cidA	0.154	0.266	2.259E-6	497	0.080	0.155	4cidA.pdb.gz	Structural Insights Into Membrane Interaction and Caveolar Targeting of Dynamin-Like Ehd2.
17	PDB:7soxA	0.158	0.262	2.071E-5	514	0.075	0.140	7soxA.pdb.gz
18	PDB:3zjcE	0.137	0.392	2.173E-3	286	0.052	0.175	3zjcE.pdb.gz	Structural Insights Into the Mechanism of Gtpase Activation in the Gimap Family.
19	PDB:1tq6A	0.124	0.257	9.380E-3	402	0.061	0.147	1tq6A.pdb.gz	Crystal Structure of IIGP1; A Paradigm for Interferon-Inducible p47 Resistance GTPases
20	PDB:6lojB	0.128	0.190	9.805E-3	571	0.093	0.156	6lojB.pdb.gz	Substrate-binding destabilizes the hydrophobic cluster to relieve the autoinhibition of bacterial ubiquitin ligase IpaH9.8.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0B4LF33	0.0	630	622	0.346	0.534	A0A0B4LF33_DROME Optic atrophy 1, isoform E OS=Drosophila melanogaster OX=7227 GN=Opa1 PE=1 SV=1
2	A0A0B4LFB8	0.0	953	930	0.517	0.533	A0A0B4LFB8_DROME Dynamin-like 120 kDa protein, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Opa1 PE=1 SV=1
3	A0A0B4LGF5	0.0	949	969	0.522	0.517	A0A0B4LGF5_DROME Dynamin-like 120 kDa protein, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Opa1 PE=1 SV=1
4	A0A2R8Y3X5	0.0	1714	854	0.871	0.979	A0A2R8Y3X5_HUMAN Dynamin-like 120 kDa protein, mitochondrial OS=Homo sapiens OX=9606 GN=OPA1 PE=1 SV=1
5	A0A2R8YDM2	0.0	1981	965	1.000	0.995	A0A2R8YDM2_HUMAN Dynamin-like 120 kDa protein, mitochondrial OS=Homo sapiens OX=9606 GN=OPA1 PE=1 SV=1
6	A0A2R8YFD1	0.0	1278	623	0.648	0.998	A0A2R8YFD1_HUMAN Dynamin-like 120 kDa protein, mitochondrial (Fragment) OS=Homo sapiens OX=9606 GN=OPA1 PE=1 SV=1
7	A1Z9N0	0.0	953	972	0.521	0.514	A1Z9N0_DROME Dynamin-like 120 kDa protein, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Opa1 PE=1 SV=1
8	C9JMB8	0.0	1947	972	0.979	0.967	C9JMB8_HUMAN Dynamin-like 120 kDa protein, mitochondrial OS=Homo sapiens OX=9606 GN=OPA1 PE=1 SV=2
9	E5KLJ9	0.0	1892	979	0.967	0.948	E5KLJ9_HUMAN Dynamin-like 120 kDa protein, mitochondrial OS=Homo sapiens OX=9606 GN=OPA1 PE=1 SV=1
10	O60313	0.0	1988	960	1.000	1.000	OPA1_HUMAN Dynamin-like 120 kDa protein, mitochondrial OS=Homo sapiens OX=9606 GN=OPA1 PE=1 SV=3
11	O93248	0.0	1536	971	0.776	0.767	OPA1_ONCMA Dynamin-like 120 kDa protein, mitochondrial OS=Oncorhynchus masou OX=8020 GN=opa1 PE=2 SV=1
12	P58281	0.0	1925	960	0.964	0.964	OPA1_MOUSE Dynamin-like 120 kDa protein, mitochondrial OS=Mus musculus OX=10090 GN=Opa1 PE=1 SV=1
13	Q18965	0.0	915	964	0.487	0.485	Q18965_CAEEL Dynamin-like 120 kDa protein, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=eat-3 PE=1 SV=3
14	Q2TA68	0.0	1922	960	0.959	0.959	OPA1_RAT Dynamin-like 120 kDa protein, mitochondrial OS=Rattus norvegicus OX=10116 GN=Opa1 PE=1 SV=1
15	Q5U3A7	0.0	1587	966	0.792	0.787	OPA1_DANRE Dynamin-like 120 kDa protein, mitochondrial OS=Danio rerio OX=7955 GN=opa1 PE=2 SV=1
16	Q95U20	0.0	958	933	0.516	0.531	Q95U20_DROME Dynamin-like 120 kDa protein, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Opa1 PE=1 SV=1
17	P42697	5.39e-27	119	610	0.092	0.144	DRP1A_ARATH Phragmoplastin DRP1A OS=Arabidopsis thaliana OX=3702 GN=DRP1A PE=1 SV=3
18	G5EB49	3.80e-26	117	696	0.095	0.131	G5EB49_EMENI Vacuolar protein sorting-associated protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_08023 PE=3 SV=1
19	P39055	7.85e-26	117	830	0.100	0.116	DYN1_CAEEL Dynamin OS=Caenorhabditis elegans OX=6239 GN=dyn-1 PE=1 SV=3
20	Q9U9I9	1.55e-25	116	838	0.100	0.115	Q9U9I9_CAEEL dynamin GTPase OS=Caenorhabditis elegans OX=6239 GN=dyn-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	3.5e+02	12.9	AAA ATPase domain
2	PF19993 DO-GTPase2	1.4e+02	13.6	Double-GTPase 2
3	PF07632 DUF1593	11	16.9	Protein of unknown function (DUF1593)
4	PF10025 DUF2267	5.7e+02	12.2	Uncharacterized conserved protein (DUF2267)
5	PF00350 Dynamin_N	8.6e-33	125.3	Dynamin family
6	PF07699 Ephrin_rec_like	8.9e+02	11.1	Tyrosine-protein kinase ephrin type A/B receptor-like
7	PF02421 FeoB_N	5.2	18.0	Ferrous iron transport protein B
8	PF01926 MMR_HSR1	0.068	24.6	50S ribosome-binding GTPase
9	PF19434 OPA1_C	1.3e-161	549.2	Dynamin-like GTPase OPA1 C-terminal
10	PF00071 Ras	1.1e+02	13.9	Ras family
11	PF08477 Roc	66	15.2	Ras of Complex, Roc, domain of DAPkinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354681

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000420617	0.979	Mitofusin-1
2	9606.ENSP00000360270	0.968	Metalloendopeptidase OMA1, mitochondrial
3	9606.ENSP00000364204	0.950	Serine/threonine-protein kinase PINK1, mitochondrial
4	9606.ENSP00000223136	0.916	Mitochondrial fission 1 protein
5	9606.ENSP00000235329	0.905	Mitofusin-2
6	9606.ENSP00000325421	0.851	Presenilins-associated rhomboid-like protein, mitochondrial
7	9606.ENSP00000441875	0.828	Prohibitin-2
8	9606.ENSP00000355865	0.802	E3 ubiquitin-protein ligase parkin
9	9606.ENSP00000479488	0.765	Prohibitin
10	9606.ENSP00000318480	0.734	ATP-dependent zinc metalloprotease YME1L1
11	9606.ENSP00000298910	0.727	Leucine-rich repeat serine/threonine-protein kinase 2
12	9606.ENSP00000258080	0.716	Serine protease HTRA2, mitochondrial
13	9606.ENSP00000302037	0.701	Mitochondrial fission factor
14	9606.ENSP00000219431	0.696	DNA-3-methyladenine glycosylase
15	9606.ENSP00000387262	0.682	MICOS complex subunit MIC60
16	9606.ENSP00000364840	0.679	Von Willebrand factor A domain containing 7
17	9606.ENSP00000392709	0.679	NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial
18	9606.ENSP00000348211	0.675	Solute carrier family 25 member 46
19	9606.ENSP00000367284	0.670	FUN14 domain-containing protein 1
20	9606.ENSP00000379057	0.655	Mitochondrial dynamics protein MID49

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003924	1.000	GTPase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016043	0.996	cellular component organization
GO:0050794	0.991	regulation of cellular process
GO:0007005	0.989	mitochondrion organization
GO:0010821	0.970	regulation of mitochondrion organization
GO:0032501	0.807	multicellular organismal process
GO:0032502	0.681	developmental process
GO:0008152	0.488	metabolic process
GO:0050896	0.479	response to stimulus
GO:0048856	0.469	anatomical structure development
GO:0048583	0.469	regulation of response to stimulus
GO:0048284	0.429	organelle fusion
GO:0048523	0.427	negative regulation of cellular process
GO:0009966	0.426	regulation of signal transduction
GO:0048522	0.421	positive regulation of cellular process
GO:0008053	0.379	mitochondrial fusion
GO:0007275	0.377	multicellular organism development
GO:0071704	0.342	organic substance metabolic process
GO:0009653	0.332	anatomical structure morphogenesis
GO:0051179	0.329	localization
GO:0048731	0.317	system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0005829	0.999	cytosol
GO:0016020	0.997	membrane
GO:0031981	0.995	nuclear lumen
GO:0005654	0.988	nucleoplasm
GO:0031090	0.976	organelle membrane
GO:0031966	0.948	mitochondrial membrane
GO:0005743	0.922	mitochondrial inner membrane
GO:0032991	0.483	protein-containing complex
GO:0005741	0.337	mitochondrial outer membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19669	1.000	GTP + H2O = GDP + H(+) + phosphate

[back to server]