StarFunc result for job id O60315

User Input

>input (1214 residues)
MKQPIMADGPRCKRRKQANPRRKNVVNYDNVVDTGSETDEEDKLHIAEDDGIANPLDQET
SPASVPNHESSPHVSQALLPREEEEDEIREGGVEHPWHNNEILQASVDGPEEMKEDYDTM
GPEATIQTAINNGTVKNANCTSDFEEYFAKRKLEERDGHAVSIEEYLQRSDTAIIYPEAP
EELSRLGTPEANGQEENDLPPGTPDAFAQLLTCPYCDRGYKRLTSLKEHIKYRHEKNEEN
FSCPLCSYTFAYRTQLERHMVTHKPGTDQHQMLTQGAGNRKFKCTECGKAFKYKHHLKEH
LRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCIGLISVNGRMRNNIKTGSSPNSVSSS
PTNSAITQLRNKLENGKPLSMSEQTGLLKIKTEPLDFNDYKVLMATHGFSGTSPFMNGGL
GATSPLGVHPSAQSPMQHLGVGMEAPLLGFPTMNSNLSEVQKVLQIVDNTVSRQKMDCKA
EEISKLKGYHMKDPCSQPEEQGVTSPNIPPVGLPVVSHNGATKSIIDYTLEKVNEAKACL
QSLTTDSRRQISNIKKEKLRTLIDLVTDDKMIENHNISTPFSCQFCKESFPGPIPLHQHE
RYLCKMNEEIKAVLQPHENIVPNKAGVFVDNKALLLSSVLSEKGMTSPINPYKDHMSVLK
AYYAMNMEPNSDELLKISIAVGLPQEFVKEWFEQRKVYQYSNSRSPSLERSSKPLAPNSN
PPTKDSLLPRSPVKPMDSITSPSIAELHNSVTNCDPPLRLTKPSHFTNIKPVEKLDHSRS
NTPSPLNLSSTSSKNSHSSSYTPNSFSSEELQAEPLDLSLPKQMKEPKSIIATKNKTKAS
SISLDHNSVSSSSENSDEPLNLTFIKKEFSNSNNLDNKSTNPVFSMNPFSAKPLYTALPP
QSAFPPATFMPPVQTSIPGLRPYPGLDQMSFLPHMAYTYPTGAATFADMQQRRKYQRKQG
FQGELLDGAQDYMSGLDDMTDSDSCLSRKKIKKTESGMYACDLCDKTFQKSSSLLRHKYE
HTGKRPHQCQICKKAFKHKHHLIEHSRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSY
CKREAEEREAAEREAREKGHLEPTELLMNRAYLQSITPQGYSDSEERESMPRDGESEKEH
EKEGEDGYGKLGRQDGDEEFEEEEEESENKSMDTDPETIRDEEETGDHSMDDSSEDGKME
TKSDHEEDNMEDGM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A1B0GV02	0.124	0.122	0.000	1239	0.999	0.979	A0A1B0GV02.pdb.gz	A0A1B0GV02_HUMAN Zinc finger E-box binding homeobox 2 OS=Homo sapiens OX=9606 GN=ZEB2 PE=1 SV=1
2	AFDB:A0A2R8QDL5	0.104	0.105	0.000	1191	0.694	0.708	A0A2R8QDL5.pdb.gz
3	AFDB:B0LVF0	0.163	0.163	0.000	1219	0.715	0.712	B0LVF0.pdb.gz	B0LVF0_DANRE SIP1b OS=Danio rerio OX=7955 GN=zfhx1b PE=2 SV=1
4	AFDB:A0A286Y942	0.173	0.170	4.688E-102	1242	0.594	0.581	A0A286Y942.pdb.gz
5	AFDB:A0A2R8RT96	0.144	0.148	6.618E-96	1175	0.577	0.596	A0A2R8RT96.pdb.gz
6	AFDB:F1QMZ5	0.116	0.118	5.929E-41	1190	0.321	0.328	F1QMZ5.pdb.gz	F1QMZ5_DANRE Zinc finger E-box-binding homeobox 1 isoform X1 OS=Danio rerio OX=7955 GN=zeb1a PE=4 SV=2
7	AFDB:Q9W4J1	0.079	0.055	1.401E-12	1894	0.164	0.105	Q9W4J1.pdb.gz	Q9W4J1_DROME Pebbled, isoform A OS=Drosophila melanogaster OX=7227 GN=peb PE=4 SV=2
8	AFDB:Q5U0U1	0.061	0.059	1.811E-10	1267	0.162	0.155	Q5U0U1.pdb.gz	Q5U0U1_DROME AT17006p OS=Drosophila melanogaster OX=7227 GN=salr PE=2 SV=1
9	AFDB:Q9Y2X9	0.067	0.084	2.608E-10	895	0.117	0.159	Q9Y2X9.pdb.gz	ZN281_HUMAN Zinc finger protein 281 OS=Homo sapiens OX=9606 GN=ZNF281 PE=1 SV=1
10	AFDB:Q9H4Z2	0.045	0.041	1.121E-9	1342	0.142	0.128	Q9H4Z2.pdb.gz	ZN335_HUMAN Zinc finger protein 335 OS=Homo sapiens OX=9606 GN=ZNF335 PE=1 SV=1
11	PDB:3w5kB	0.036	0.227	4.477E-3	110	0.027	0.300	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:4egcA	0.043	0.095	1.604E-2	539	0.012	0.026	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
13	PDB:2hi3A	0.043	0.618	1.812E-2	73	0.016	0.260	2hi3A.pdb.gz
14	PDB:7fbyA	0.037	0.242	1.440	153	0.006	0.046	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
15	PDB:3wqyA	0.047	0.061	1.531	905	0.010	0.013	3wqyA.pdb.gz	The selective tRNA aminoacylation mechanism based on a single G.U pair
16	PDB:3femA	0.033	0.127	1.626	281	0.006	0.025	3femA.pdb.gz
17	PDB:5dkaA	0.030	0.203	1.952	96	0.010	0.125	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
18	PDB:5nr5A	0.040	0.334	2.074	113	0.012	0.124	5nr5A.pdb.gz
19	PDB:7awtE	0.032	0.218	2.074	156	0.006	0.045	7awtE.pdb.gz	Structure of the peripheral arm of a minimalistic respiratory complex I.
20	PDB:6hxgA	0.031	0.128	2.342	264	0.005	0.023	6hxgA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1B0GV02	0.0	2514	1239	1.000	0.980	A0A1B0GV02_HUMAN Zinc finger E-box binding homeobox 2 OS=Homo sapiens OX=9606 GN=ZEB2 PE=1 SV=1
2	A0A1B0GVV8	0.0	2289	1102	0.908	1.000	A0A1B0GVV8_HUMAN Zinc finger E-box binding homeobox 2 OS=Homo sapiens OX=9606 GN=ZEB2 PE=1 SV=1
3	A0A1B0GW50	0.0	2251	1202	0.891	0.900	A0A1B0GW50_HUMAN Zinc finger E-box binding homeobox 2 OS=Homo sapiens OX=9606 GN=ZEB2 PE=1 SV=1
4	A0JP08	0.0	2518	1213	0.999	1.000	A0JP08_HUMAN Zinc finger E-box binding homeobox 2 OS=Homo sapiens OX=9606 GN=ZEB2 PE=1 SV=1
5	B0LVE9	0.0	1316	1201	0.615	0.622	B0LVE9_DANRE SIP1a OS=Danio rerio OX=7955 GN=si:dkey-52o2.2 PE=1 SV=1
6	B0LVF0	0.0	1643	1219	0.717	0.714	B0LVF0_DANRE SIP1b OS=Danio rerio OX=7955 GN=zfhx1b PE=2 SV=1
7	B5DE38	0.0	1189	1175	0.575	0.594	B5DE38_DANRE Zinc finger E-box-binding homeobox 2 isoform 2 OS=Danio rerio OX=7955 GN=wu:fc92g08 PE=1 SV=1
8	F1QY45	0.0	1312	1218	0.614	0.612	F1QY45_DANRE Zinc finger E-box-binding homeobox 2 isoform X2 OS=Danio rerio OX=7955 GN=si:dkey-52o2.2 PE=1 SV=1
9	O60315	0.0	2524	1214	1.000	1.000	ZEB2_HUMAN Zinc finger E-box-binding homeobox 2 OS=Homo sapiens OX=9606 GN=ZEB2 PE=1 SV=1
10	P37275	0.0	776	1124	0.442	0.477	ZEB1_HUMAN Zinc finger E-box-binding homeobox 1 OS=Homo sapiens OX=9606 GN=ZEB1 PE=1 SV=2
11	Q62947	0.0	730	1109	0.413	0.452	ZEB1_RAT Zinc finger E-box-binding homeobox 1 OS=Rattus norvegicus OX=10116 GN=Zeb1 PE=1 SV=2
12	Q64318	0.0	752	1117	0.409	0.445	ZEB1_MOUSE Zinc finger E-box-binding homeobox 1 OS=Mus musculus OX=10090 GN=Zeb1 PE=1 SV=1
13	Q9DEH7	0.0	645	1078	0.377	0.425	Q9DEH7_DANRE Kheper OS=Danio rerio OX=7955 GN=kheper PE=1 SV=1
14	Q9R0G7	0.0	2446	1215	0.967	0.966	ZEB2_MOUSE Zinc finger E-box-binding homeobox 2 OS=Mus musculus OX=10090 GN=Zeb2 PE=1 SV=2
15	U3KQ51	0.0	1977	955	0.787	1.000	U3KQ51_HUMAN Zinc finger E-box binding homeobox 2 OS=Homo sapiens OX=9606 GN=ZEB2 PE=1 SV=3
16	F6TDF5	1.10e-121	379	289	0.162	0.682	F6TDF5_HUMAN Zinc finger E-box-binding homeobox 1 (Fragment) OS=Homo sapiens OX=9606 GN=ZEB1 PE=1 SV=1
17	F1QMZ5	5.67e-63	237	1190	0.176	0.180	F1QMZ5_DANRE Zinc finger E-box-binding homeobox 1 isoform X1 OS=Danio rerio OX=7955 GN=zeb1a PE=4 SV=2
18	F1QBD3	1.89e-61	232	1176	0.163	0.168	F1QBD3_DANRE Zinc finger E-box-binding homeobox 1 isoform X2 OS=Danio rerio OX=7955 GN=zeb1a PE=4 SV=2
19	G5EBU4	9.73e-43	168	596	0.058	0.117	ZAG1_CAEEL Zinc finger E-box-binding homeobox protein zag-1 OS=Caenorhabditis elegans OX=6239 GN=zag-1 PE=2 SV=1
20	P28166	2.37e-37	155	1054	0.055	0.064	ZFH1_DROME Zinc finger protein 1 OS=Drosophila melanogaster OX=7227 GN=zfh1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00046 Homeodomain	0.41	21.8	Homeodomain
2	PF00096 zf-C2H2	2.5e-21	86.0	Zinc finger, C2H2 type
3	PF13894 zf-C2H2_4	3e-12	57.3	C2H2-type zinc finger
4	PF13912 zf-C2H2_6	5.2e+02	12.1	C2H2-type zinc finger
5	PF12171 zf-C2H2_jaz	0.00015	33.2	Zinc-finger double-stranded RNA-binding
6	PF05605 zf-Di19	5.6e-05	34.7	Drought induced 19 protein (Di19), zinc-binding
7	PF13465 zf-H2C2_2	1.4e-27	106.1	Zinc-finger double domain
8	PF13909 zf-H2C2_5	17	16.6	C2H2-type zinc-finger domain
9	PF12874 zf-met	0.00084	30.9	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000454157

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000290921	0.995	C-terminal-binding protein 1
2	9606.ENSP00000264245	0.957	Rho GTPase-activating protein 31
3	9606.ENSP00000332973	0.916	Mothers against decapentaplegic homolog 3
4	9606.ENSP00000261769	0.870	Cadherin-1
5	9606.ENSP00000242261	0.846	Twist-related protein 1
6	9606.ENSP00000362649	0.835	Histone deacetylase 1
7	9606.ENSP00000354487	0.825	Zinc finger E-box-binding homeobox 1
8	9606.ENSP00000482581	0.789	Twist-related protein 2
9	9606.ENSP00000269141	0.781	Cadherin-2
10	9606.ENSP00000475473	0.766	Protein Churchill
11	9606.ENSP00000262160	0.764	Mothers against decapentaplegic homolog 2
12	9606.ENSP00000426568	0.764	Mothers against decapentaplegic homolog 1
13	9606.ENSP00000368632	0.750	Trans-acting T-cell-specific transcription factor GATA-3
14	9606.ENSP00000446007	0.731	Vimentin
15	9606.ENSP00000380093	0.714	Transcription factor SOX-10
16	9606.ENSP00000323588	0.702	Transcription factor SOX-2
17	9606.ENSP00000326371	0.694	Forkhead box protein C2
18	9606.ENSP00000346839	0.689	Fibronectin type III domain containing
19	9606.ENSP00000364678	0.679	Histone-lysine N-methyltransferase EHMT2
20	9606.ENSP00000344456	0.671	Catenin beta-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000981	1.000	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001067	0.999	transcription regulatory region nucleic acid binding
GO:0043565	0.998	sequence-specific DNA binding
GO:0000977	0.993	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.985	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.964	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001228	0.889	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001217	0.814	DNA-binding transcription repressor activity
GO:0001227	0.787	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0008134	0.624	transcription factor binding
GO:0003682	0.462	chromatin binding
GO:0140297	0.361	DNA-binding transcription factor binding
GO:0019899	0.308	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.979	regulation of cellular process
GO:0009987	0.977	cellular process
GO:0048856	0.976	anatomical structure development
GO:0032501	0.975	multicellular organismal process
GO:0007275	0.968	multicellular organism development
GO:0048523	0.965	negative regulation of cellular process
GO:0010646	0.956	regulation of cell communication
GO:0048518	0.947	positive regulation of biological process
GO:0023051	0.910	regulation of signaling
GO:0048522	0.888	positive regulation of cellular process
GO:0048513	0.886	animal organ development
GO:0009888	0.870	tissue development
GO:0010604	0.856	positive regulation of macromolecule metabolic process
GO:0000122	0.850	negative regulation of transcription by RNA polymerase II
GO:0048583	0.842	regulation of response to stimulus
GO:0009653	0.828	anatomical structure morphogenesis
GO:0051173	0.820	positive regulation of nitrogen compound metabolic process
GO:0030154	0.811	cell differentiation
GO:0031325	0.773	positive regulation of cellular metabolic process
GO:0050896	0.697	response to stimulus
GO:0009966	0.656	regulation of signal transduction
GO:0009891	0.619	positive regulation of biosynthetic process
GO:0045935	0.596	positive regulation of nucleobase-containing compound metabolic process
GO:0048870	0.586	cell motility
GO:0016477	0.557	cell migration
GO:0031328	0.557	positive regulation of cellular biosynthetic process
GO:0010557	0.537	positive regulation of macromolecule biosynthetic process
GO:0001667	0.521	ameboidal-type cell migration
GO:0051254	0.490	positive regulation of RNA metabolic process
GO:0045893	0.484	positive regulation of DNA-templated transcription
GO:0045944	0.440	positive regulation of transcription by RNA polymerase II
GO:0050793	0.421	regulation of developmental process
GO:0048731	0.411	system development
GO:0051716	0.393	cellular response to stimulus
GO:0009790	0.344	embryo development
GO:0048646	0.339	anatomical structure formation involved in morphogenesis
GO:0060429	0.325	epithelium development
GO:0048584	0.302	positive regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0005829	0.998	cytosol
GO:0005730	0.900	nucleolus
GO:0032991	0.492	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]