StarFunc result for job id O60318

User Input

>input (1980 residues)
MNPTNPFSGQQPSAFSASSSNVGTLPSKPPFRFGQPSLFGQNSTLSGKSSGFSQVSSFPA
SSGVSHSSSVQTLGFTQTSSVGPFSGLEHTSTFVATSGPSSSSVLGNTGFSFKSPTSVGA
FPSTSAFGQEAGEIVNSGFGKTEFSFKPLENAVFKPILGAESEPEKTQSQIASGFFTFSH
PISSAPGGLAPFSFPQVTSSSATTSNFTFSKPVSSNNSLSAFTPALSNQNVEEEKRGPKS
IFGSSNNSFSSFPVSSAVLGEPFQASKAGVRQGCEEAVSQVEPLPSLMKGLKRKEDQDRS
PRRHGHEPAEDSDPLSRGDHPPDKRPVRLNRPRGGTLFGRTIQDVFKSNKEVGRLGNKEA
KKETGFVESAESDHMAIPGGNQSVLAPSRIPGVNKEEETESREKKEDSLRGTPARQSNRS
ESTDSLGGLSPSEVTAIQCKNIPDYLNDRTILENHFGKIAKVQRIFTRRSKKLAVVHFFD
HASAALARKKGKSLHKDMAIFWHRKKISPNKKPFSLKEKKPGDGEVSPSTEDAPFQHSPL
GKAAGRTGASSLLNKSSPVKKPSLLKAHQFEGDSFDSASEGSEGLGPCVLSLSTLIGTVA
ETSKEKYRLLDQRDRIMRQARVKRTDLDKARTFVGTCLDMCPEKERYMRETRSQLSVFEV
VPGTDQVDHAAAVKEYSRSSADQEEPLPHELRPLPVLSRTMDYLVTQIMDQKEGSLRDWY
DFVWNRTRGIRKDITQQHLCDPLTVSLIEKCTRFHIHCAHFMCEEPMSSFDAKINNENMT
KCLQSLKEMYQDLRNKGVFCASEAEFQGYNVLLSLNKGDILREVQQFHPAVRNSSEVKFA
VQAFAALNSNNFVRFFKLVQSASYLNACLLHCYFSQIRKDALRALNFAYTVSTQRSTIFP
LDGVVRMLLFRDCEEATDFLTCHGLTVSDGCVELNRSAFLEPEGLSKTRKSVFITRKLTV
SVGEIVNGGPLPPVPRHTPVCSFNSQNKYIGESLAAELPVSTQRPGSDTVGGGRGEECGV
EPDAPLSSLPQSLPAPAPSPVPLPPVLALTPSVAPSLFQLSVQPEPPPPEPVPMYSDEDL
AQVVDELIQEALQRDCEEVGSAGAAYAAAALGVSNAAMEDLLTAATTGILRHIAAEEVSK
ERERREQERQRAEEERLKQERELVLSELSQGLAVELMERVMMEFVRETCSQELKNAVETD
QRVRVARCCEDVCAHLVDLFLVEEIFQTAKETLQELQCFCKYLQRWREAVTARKKLRRQM
RAFPAAPCCVDVSDRLRALAPSAECPIAEENLARGLLDLGHAGRLGISCTRLRRLRNKTA
HQMKVQHFYQQLLSDVAWASLDLPSLVAEHLPGRQEHVFWKLVLVLPDVEEQSPESCGRI
LANWLKVKFMGDEGSVDDTSSDAGGIQTLSLFNSLSSKGDQMISVNVCIKVAHGALSDGA
IDAVETQKDLLGASGLMLLLPPKMKSEDMAEEDVYWLSALLQLKQLLQAKPFQPALPLVV
LVPSPGGDAVEKEVEDGLMLQDLVSAKLISDYTVTEIPDTINDLQGSTKVLQAVQWLVSH
CPHSLDLCCQTLIQYVEDGIGHEFSGRFFHDRRERRLGGLASQEPGAIIELFNSVLQFLA
SVVSSEQLCDLSWPVTEFAEAGGSRLLPHLHWNAPEHLAWLKQAVLGFQLPQMDLPPLGA
PWLPVCSMVVQYASQIPSSRQTQPVLQSQVENLLHRTYCRWKSKSPSPVHGAGPSVMEIP
WDDLIALCINHKLRDWTPPRLPVTSEALSEDGQICVYFFKNDLKKYDVPLSWEQARLQTQ
KELQLREGRLAIKPFHPSANNFPIPLLHMHRNWKRSTECAQEGRIPSTEDLMRGASAEEL
LAQCLSSSLLLEKEENKRFEDQLQQWLSEDSGAFTDLTSLPLYLPQTLVSLSHTIEPVMK
TSVTTSPQSDMMREQLQLSEATGTCLGERLKHLERLIRSSREEEVASELHLSALLDMVDI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60318	1.000	1.000	0.000	1980	1.000	1.000	O60318.pdb.gz	GANP_HUMAN Germinal-center associated nuclear protein OS=Homo sapiens OX=9606 GN=MCM3AP PE=1 SV=2
2	AFDB:F4JAU2	0.271	0.306	2.371E-43	1697	0.177	0.206	F4JAU2.pdb.gz	SAC3B_ARATH SAC3 family protein B OS=Arabidopsis thaliana OX=3702 GN=SAC3B PE=1 SV=1
3	AFDB:F4IUY8	0.118	0.222	3.631E-14	1006	0.094	0.186	F4IUY8.pdb.gz	SAC3A_ARATH SAC3 family protein A OS=Arabidopsis thaliana OX=3702 GN=SAC3A PE=1 SV=1
4	PDB:5l3tA	0.132	0.829	3.163E-11	294	0.038	0.259	5l3tA.pdb.gz	The Sac3 TPR-like region in the Saccharomyces cerevisiae TREX-2 complex is more extensive but independent of the CID region.
5	AFDB:Q9LVX1	0.043	0.083	7.026E-6	908	0.054	0.117	Q9LVX1.pdb.gz	C3H41_ARATH Zinc finger CCCH domain-containing protein 41 OS=Arabidopsis thaliana OX=3702 GN=At3g27700 PE=1 SV=1
6	AFDB:Q5T8P6	0.039	0.075	7.711E-6	1007	0.049	0.096	Q5T8P6.pdb.gz	RBM26_HUMAN RNA-binding protein 26 OS=Homo sapiens OX=9606 GN=RBM26 PE=1 SV=3
7	AFDB:A0A0K3AU72	0.066	0.073	8.867E-6	1698	0.126	0.147	A0A0K3AU72.pdb.gz	A0A0K3AU72_CAEEL Formin HOmology Domain OS=Caenorhabditis elegans OX=6239 GN=fhod-1 PE=1 SV=1
8	PDB:5c2kA	0.067	0.270	5.312E-5	382	0.021	0.107	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
9	PDB:2zetA	0.071	0.477	1.019E-4	181	0.012	0.133	2zetA.pdb.gz	Structural basis for the exclusive specificity of Slac2-a/melanophilin for the Rab27 GTPases.
10	PDB:7e1tB	0.071	0.542	2.355E-4	174	0.013	0.144	7e1tB.pdb.gz	Nde1 is a Rab9 effector for loading late endosomes to cytoplasmic dynein motor complex.
11	PDB:6jikA	0.064	0.414	6.258E-4	182	0.012	0.126	6jikA.pdb.gz	Aspergillus fumigatus Rho1 gSGTP complex
12	PDB:6ukaA	0.063	0.431	7.195E-4	177	0.011	0.119	6ukaA.pdb.gz	Structure of the DOCK2-ELMO1 complex provides insights into regulation of the auto-inhibited state.
13	AFDB:Q8K1N2	0.039	0.052	7.376E-4	1249	0.083	0.131	Q8K1N2.pdb.gz	PHLB2_MOUSE Pleckstrin homology-like domain family B member 2 OS=Mus musculus OX=10090 GN=Phldb2 PE=1 SV=2
14	PDB:6cesA	0.070	0.326	7.538E-4	300	0.015	0.097	6cesA.pdb.gz	Architecture of the human GATOR1 and GATOR1-Rag GTPases complexes.
15	AFDB:Q8BI84	0.034	0.034	8.096E-4	1930	0.124	0.127	Q8BI84.pdb.gz	TGO1_MOUSE Transport and Golgi organization protein 1 homolog OS=Mus musculus OX=10090 GN=Mia3 PE=1 SV=2
16	AFDB:F4HWC3	0.029	0.040	8.886E-4	1364	0.092	0.134	F4HWC3.pdb.gz	F4HWC3_ARATH Calponin-like domain protein OS=Arabidopsis thaliana OX=3702 GN=At1g20970 PE=1 SV=1
17	PDB:5szhB	0.069	0.468	9.513E-4	175	0.016	0.177	5szhB.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
18	PDB:1zbdA	0.068	0.478	9.966E-4	177	0.014	0.153	1zbdA.pdb.gz	Structural basis of Rab effector specificity: crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A.
19	AFDB:Q86SQ0	0.057	0.074	1.022E-3	1253	0.084	0.132	Q86SQ0.pdb.gz	PHLB2_HUMAN Pleckstrin homology-like domain family B member 2 OS=Homo sapiens OX=9606 GN=PHLDB2 PE=1 SV=2
20	PDB:4ileA	0.068	0.543	1.201E-3	176	0.017	0.193	4ileA.pdb.gz	Structure of human ADP-ribosylation factor-like 8A binding to GDP

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60318	0.0	4069	1980	1.000	1.000	GANP_HUMAN Germinal-center associated nuclear protein OS=Homo sapiens OX=9606 GN=MCM3AP PE=1 SV=2
2	Q9WUU9	0.0	2997	1971	0.786	0.789	GANP_MOUSE Germinal-center associated nuclear protein OS=Mus musculus OX=10090 GN=Mcm3ap PE=1 SV=2
3	Q9U3V9	2.60e-90	330	2079	0.106	0.101	XMAS_DROME Protein xmas OS=Drosophila melanogaster OX=7227 GN=xmas PE=1 SV=4
4	O74889	2.02e-53	207	1024	0.071	0.137	SAC31_SCHPO SAC3 family protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC576.05 PE=1 SV=1
5	F4JAU2	9.70e-47	188	1697	0.060	0.070	SAC3B_ARATH SAC3 family protein B OS=Arabidopsis thaliana OX=3702 GN=SAC3B PE=1 SV=1
6	A6NKF1	8.47e-32	132	404	0.048	0.238	SAC31_HUMAN SAC3 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SAC3D1 PE=1 SV=2
7	P46674	2.17e-31	137	1301	0.088	0.135	SAC3_YEAST Nuclear mRNA export protein SAC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SAC3 PE=1 SV=2
8	Q9USI4	9.55e-30	127	458	0.054	0.231	SAC32_SCHPO SAC3 family protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC70.06 PE=3 SV=1
9	A6H687	6.33e-22	103	427	0.051	0.234	SAC31_MOUSE SAC3 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Sac3d1 PE=1 SV=1
10	F4IUY8	2.23e-10	68.6	1006	0.033	0.065	SAC3A_ARATH SAC3 family protein A OS=Arabidopsis thaliana OX=3702 GN=SAC3A PE=1 SV=1
11	Q96PV6	3.27e-07	58.2	800	0.024	0.060	LENG8_HUMAN Leukocyte receptor cluster member 8 OS=Homo sapiens OX=9606 GN=LENG8 PE=1 SV=3
12	P49686	6.03e-04	47.0	430	0.032	0.147	NUP42_YEAST Nucleoporin NUP42 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NUP42 PE=1 SV=1
13	Q1MTP1	0.42	37.7	395	0.024	0.122	THP3_SCHPO THP3 homolog C2A9.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC2A9.11c PE=3 SV=1
14	M9PC48	0.58	37.7	18095	0.009	0.001	M9PC48_DROME Dumpy, isoform Y OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
15	M9PCJ6	0.58	37.7	18641	0.009	0.001	M9PCJ6_DROME Dumpy, isoform S OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
16	Q9VIV2	0.67	37.4	1062	0.010	0.019	SWM_DROME Zinc finger protein swm OS=Drosophila melanogaster OX=7227 GN=swm PE=1 SV=1
17	Q387F2	0.98	37.0	1553	0.021	0.026	Q387F2_TRYB2 Nucleoporin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0140 PE=4 SV=1
18	P40477	1.0	37.0	1460	0.035	0.047	NU159_YEAST Nucleoporin NUP159 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NUP159 PE=1 SV=1
19	Q8TEK3	2.7	35.4	1537	0.013	0.016	DOT1L_HUMAN Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Homo sapiens OX=9606 GN=DOT1L PE=1 SV=3
20	P36188	2.8	34.7	269	0.011	0.078	TNNI_DROME Troponin I OS=Drosophila melanogaster OX=7227 GN=wupA PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16766 CID_GANP	1.1e-28	110.6	Binding region of GANP to ENY2
2	PF16769 MCM3AP_GANP	0	1204.6	MCM3AP domain of GANP
3	PF16768 NupH_GANP	1.9e-143	488.9	Nucleoporin homology of Germinal-centre associated nuclear protein
4	PF00076 RRM_1	71	14.7	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
5	PF03399 SAC3_GANP	2e-107	370.4	SAC3/GANP family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000380820

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000428259	0.999	Centrin-3
2	9606.ENSP00000429986	0.999	Transcription and mRNA export factor ENY2
3	9606.ENSP00000479494	0.999	PCI domain containing 2
4	9606.ENSP00000436679	0.994	Nuclear RNA export factor 1
5	9606.ENSP00000480987	0.992	DNA replication licensing factor MCM3
6	9606.ENSP00000359300	0.983	Centrin-2
7	9606.ENSP00000444029	0.982	Nuclear pore complex protein Nup153
8	9606.ENSP00000385334	0.968	Mitotic spindle assembly checkpoint protein MAD1
9	9606.ENSP00000356448	0.965	Nucleoprotein TPR
10	9606.ENSP00000316032	0.953	Nuclear pore complex protein Nup98-Nup96
11	9606.ENSP00000481021	0.935	Putative protein SEM1, isoform 2
12	9606.ENSP00000283195	0.931	E3 SUMO-protein ligase RanBP2
13	9606.ENSP00000245838	0.908	THO complex subunit 2
14	9606.ENSP00000296509	0.903	Mitotic spindle assembly checkpoint protein MAD2A
15	9606.ENSP00000426978	0.883	Nuclear RNA export factor 5
16	9606.ENSP00000471191	0.819	Nuclear pore glycoprotein p62
17	9606.ENSP00000379182	0.798	mRNA export factor
18	9606.ENSP00000319052	0.796	Centrin-1
19	9606.ENSP00000355050	0.776	Beta-catenin-like protein 1
20	9606.ENSP00000242776	0.767	ATP-dependent RNA helicase DDX39A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003682	1.000	chromatin binding
GO:0042393	1.000	histone binding
GO:0010484	1.000	histone H3 acetyltransferase activity
GO:1901363	0.708	heterocyclic compound binding
GO:0097159	0.708	organic cyclic compound binding
GO:0003676	0.704	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.993	organic substance metabolic process
GO:0009987	0.986	cellular process
GO:0043170	0.984	macromolecule metabolic process
GO:0006406	0.965	mRNA export from nucleus
GO:0016043	0.959	cellular component organization
GO:0048856	0.911	anatomical structure development
GO:0007275	0.895	multicellular organism development
GO:0002440	0.880	production of molecular mediator of immune response
GO:0048731	0.869	system development
GO:0002200	0.737	somatic diversification of immune receptors
GO:0043933	0.721	protein-containing complex organization
GO:0016973	0.613	poly(A)+ mRNA export from nucleus
GO:0071824	0.479	protein-DNA complex subunit organization
GO:0050789	0.436	regulation of biological process
GO:0050794	0.432	regulation of cellular process
GO:0002377	0.305	immunoglobulin production

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	0.998	nucleoplasm
GO:0032991	0.996	protein-containing complex
GO:0012505	0.994	endomembrane system
GO:0005829	0.993	cytosol
GO:0016020	0.990	membrane
GO:0031975	0.978	envelope
GO:0140513	0.971	nuclear protein-containing complex
GO:0031967	0.955	organelle envelope
GO:0005643	0.954	nuclear pore
GO:0031090	0.944	organelle membrane
GO:0043232	0.779	intracellular non-membrane-bounded organelle
GO:0044615	0.707	nuclear pore nuclear basket
GO:0031965	0.603	nuclear membrane
GO:0070390	0.396	transcription export complex 2

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:21992	1.000	acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone]
EC:2.3.1.48	1.000	histone acetyltransferase.

[back to server]