StarFunc result for job id O60331

User Input

>input (668 residues)
MELEVPDEAESAEAGAVPSEAAWAAESGAAAGLAQKKAAPTEVLSMTAQPGPGHGKKLGH
RGVDASGETTYKKTTSSTLKGAIQLGIGYTVGHLSSKPERDVLMQDFYVVESIFFPSEGS
NLTPAHHFQDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCNEPLIELSNPGASGSLFYVT
SDDEFIIKTVMHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQSGGKNIRVVVMNN
ILPRVVKMHLKFDLKGSTYKRRASKKEKEKSFPTYKDLDFMQDMPEGLLLDADTFSALVK
TLQRDCLVLESFKIMDYSLLLGVHNIDQHERERQAQGAQSTSDEKRPVGQKALYSTAMES
IQGGAARGEAIESDDTMGGIPAVNGRGERLLLHIGIIDILQSYRFIKKLEHTWKALVHDG
DTVSVHRPSFYAERFFKFMSNTVFRKNSSLKSSPSKKGRGGALLAVKPLGPTAAFSASQI
PSEREEAQYDLRGARSYPTLEDEGRPDLLPCTPPSFEEATTASIATTLSSTSLSIPERSP
SETSEQPRYRRRTQSSGQDGRPQEEPPAEEDLQQITVQVEPACSVEIVVPKEEDAGVEAS
PAGASAAVEVETASQASDEEGAPASQASDEEDAPATDIYFPTDERSWVYSPLHYSAQAPP
ASDGESDT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60331	1.000	1.000	0.000	668	1.000	1.000	O60331.pdb.gz	PI51C_HUMAN Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma OS=Homo sapiens OX=9606 GN=PIP5K1C PE=1 SV=2
2	AFDB:Q5I6B8	0.635	0.618	2.898E-96	688	0.913	0.887	Q5I6B8.pdb.gz	PI51C_RAT Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma OS=Rattus norvegicus OX=10116 GN=Pip5k1c PE=1 SV=1
3	AFDB:A0A2R8QMJ9	0.637	0.713	2.315E-69	592	0.570	0.644	A0A2R8QMJ9.pdb.gz
4	AFDB:Q99755	0.579	0.684	2.086E-68	562	0.530	0.630	Q99755.pdb.gz	PI51A_HUMAN Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha OS=Homo sapiens OX=9606 GN=PIP5K1A PE=1 SV=1
5	AFDB:Q503I3	0.609	0.724	1.509E-67	559	0.491	0.587	Q503I3.pdb.gz	Q503I3_DANRE Phosphatidylinositol-4-phosphate 5-kinase type-1 gamma OS=Danio rerio OX=7955 GN=pip5k1a PE=1 SV=1
6	AFDB:O14986	0.587	0.719	1.715E-64	540	0.503	0.622	O14986.pdb.gz	PI51B_HUMAN Phosphatidylinositol 4-phosphate 5-kinase type-1 beta OS=Homo sapiens OX=9606 GN=PIP5K1B PE=1 SV=2
7	AFDB:Q9W2R3	0.569	0.483	9.241E-58	792	0.388	0.327	Q9W2R3.pdb.gz	Q9W2R3_DROME LP03320p OS=Drosophila melanogaster OX=7227 GN=sktl PE=1 SV=2
8	AFDB:Q7JNK2	0.421	0.595	3.445E-39	462	0.290	0.420	Q7JNK2.pdb.gz	Q7JNK2_DROME Putative phosphatidyl-inositol-4-phosphate 5-kinase OS=Drosophila melanogaster OX=7227 GN=sktl PE=4 SV=1
9	AFDB:B3DJ34	0.446	0.721	5.542E-33	404	0.166	0.275	B3DJ34.pdb.gz	B3DJ34_DANRE Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha OS=Danio rerio OX=7955 GN=LOC560360 PE=1 SV=1
10	PDB:6ym4A	0.418	0.838	1.095E-27	322	0.148	0.307	6ym4A.pdb.gz	Discovery and Characterization of the Potent and Highly Selective 1,7-Naphthyridine-Based Inhibitors BAY-091 and BAY-297 of the Kinase PIP4K2A.
11	PDB:1bo1A	0.417	0.816	1.157E-27	326	0.162	0.331	1bo1A.pdb.gz
12	PDB:7em5B	0.377	0.821	3.945E-24	297	0.150	0.337	7em5B.pdb.gz	The GTP responsiveness of PI5P4K beta evolved from a compromised trade-off between activity and specificity.
13	PDB:7n81B	0.392	0.820	2.064E-22	307	0.139	0.303	7n81B.pdb.gz	Pharmacological inhibition of PI5P4K alpha / beta disrupts cell energy metabolism and selectively kills p53-null tumor cells.
14	AFDB:Q8I239	0.426	0.176	4.279E-21	1710	0.159	0.062	Q8I239.pdb.gz	PI51N_PLAF7 Phosphatidylinositol 4-phosphate 5-kinase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PIP5K PE=1 SV=1
15	PDB:2gk9B	0.344	0.895	6.422E-16	250	0.126	0.336	2gk9B.pdb.gz
16	PDB:6fadC	0.133	0.220	1.582E-2	359	0.025	0.047	6fadC.pdb.gz	Molecular Mechanism of SR Protein Kinase 1 Inhibition by the Herpes Virus Protein ICP27.
17	PDB:2rsvA	0.144	0.210	6.252E-2	403	0.057	0.094	2rsvA.pdb.gz
18	PDB:4yc3A	0.124	0.235	6.978E-2	295	0.021	0.047	4yc3A.pdb.gz
19	PDB:2bujA	0.109	0.217	8.229E-2	291	0.024	0.055	2bujA.pdb.gz	Crystal Structure of the Human Serine-Threonine Kinase 16 in Complex with Staurosporine
20	PDB:6dflA	0.134	0.295	1.681E-1	241	0.031	0.087	6dflA.pdb.gz	Acylated-acyl carrier protein stabilizes the Pseudomonas aeruginosa WaaP lipopolysaccharide heptose kinase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0B4K7E3	0.0	546	777	0.394	0.338	A0A0B4K7E3_DROME Phosphatidylinositol 4-phosphate 5-kinase 59B, isoform F OS=Drosophila melanogaster OX=7227 GN=PIP5K59B PE=1 SV=1
2	A0A0B4K7M0	0.0	551	756	0.401	0.354	A0A0B4K7M0_DROME Phosphatidylinositol 4-phosphate 5-kinase 59B, isoform H OS=Drosophila melanogaster OX=7227 GN=PIP5K59B PE=1 SV=1
3	A2VD51	0.0	679	584	0.531	0.608	A2VD51_DANRE Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha OS=Danio rerio OX=7955 GN=zgc:158838 PE=1 SV=1
4	A6PW57	0.0	709	550	0.531	0.645	A6PW57_HUMAN Phosphatidylinositol-4-phosphate 5-kinase type 1 alpha OS=Homo sapiens OX=9606 GN=PIP5K1A PE=1 SV=2
5	D3ZSI8	0.0	709	546	0.513	0.628	PI51A_RAT Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha OS=Rattus norvegicus OX=10116 GN=Pip5k1a PE=1 SV=1
6	O14986	0.0	678	540	0.497	0.615	PI51B_HUMAN Phosphatidylinositol 4-phosphate 5-kinase type-1 beta OS=Homo sapiens OX=9606 GN=PIP5K1B PE=1 SV=2
7	O60331	0.0	1376	668	1.000	1.000	PI51C_HUMAN Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma OS=Homo sapiens OX=9606 GN=PIP5K1C PE=1 SV=2
8	O70161	0.0	1199	661	0.919	0.929	PI51C_MOUSE Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma OS=Mus musculus OX=10090 GN=Pip5k1c PE=1 SV=2
9	P70181	0.0	674	539	0.501	0.622	PI51B_MOUSE Phosphatidylinositol 4-phosphate 5-kinase type-1 beta OS=Mus musculus OX=10090 GN=Pip5k1b PE=1 SV=1
10	P70182	0.0	716	546	0.518	0.634	PI51A_MOUSE Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha OS=Mus musculus OX=10090 GN=Pip5k1a PE=1 SV=2
11	Q0E8Y1	0.0	546	781	0.397	0.339	Q0E8Y1_DROME Phosphatidylinositol 4-phosphate 5-kinase 59B, isoform I OS=Drosophila melanogaster OX=7227 GN=PIP5K59B PE=1 SV=3
12	Q503I3	0.0	649	559	0.496	0.592	Q503I3_DANRE Phosphatidylinositol-4-phosphate 5-kinase type-1 gamma OS=Danio rerio OX=7955 GN=pip5k1a PE=1 SV=1
13	Q5I6B8	0.0	1156	688	0.915	0.888	PI51C_RAT Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma OS=Rattus norvegicus OX=10116 GN=Pip5k1c PE=1 SV=1
14	Q8T0K5	0.0	548	729	0.400	0.366	Q8T0K5_DROME GH26019p OS=Drosophila melanogaster OX=7227 GN=PIP5K59B PE=2 SV=1
15	Q99755	0.0	708	562	0.528	0.628	PI51A_HUMAN Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha OS=Homo sapiens OX=9606 GN=PIP5K1A PE=1 SV=1
16	Q9W1Y2	0.0	551	729	0.401	0.368	Q9W1Y2_DROME FI05352p OS=Drosophila melanogaster OX=7227 GN=PIP5K59B PE=1 SV=2
17	Q9W1Y3	0.0	545	750	0.394	0.351	Q9W1Y3_DROME Phosphatidylinositol 4-phosphate 5-kinase 59B, isoform E OS=Drosophila melanogaster OX=7227 GN=PIP5K59B PE=1 SV=3
18	O01759	1.22e-171	505	611	0.350	0.383	O01759_CAEEL PIPK domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ppk-1 PE=1 SV=2
19	Q9W2R3	8.99e-168	501	792	0.368	0.311	Q9W2R3_DROME LP03320p OS=Drosophila melanogaster OX=7227 GN=sktl PE=1 SV=2
20	Q94544	9.18e-168	498	700	0.365	0.349	Q94544_DROME Phosphatidylinositol 4-phosphate 5-kinase OS=Drosophila melanogaster OX=7227 GN=sktl PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01504 PIP5K	1.7e-88	308.1	Phosphatidylinositol-4-phosphate 5-Kinase
2	PF08121 Toxin_33	8.3e+02	11.2	Waglerin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9555.ENSPANP00000001914

Rank	PPI partner	STRING score	Description
1	9555.ENSPANP00000004666	0.982	Phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit delta
2	9555.ENSPANP00000015901	0.981	Phosphatidylinositol 4-kinase, catalytic, alpha
3	9555.ENSPANP00000020794	0.976	Phosphatidylinositol 4-kinase type 2 alpha
4	9555.ENSPANP00000018523	0.973	Uncharacterized protein
5	9555.ENSPANP00000020829	0.972	Phospholipase C, delta 3
6	9555.ENSPANP00000011873	0.971	Phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit beta
7	9555.ENSPANP00000002108	0.970	Phospholipase C, delta 1
8	9555.ENSPANP00000007118	0.970	Phospholipase C, eta 1
9	9555.ENSPANP00000015459	0.970	Phospholipase C, eta 2
10	9555.ENSPANP00000004388	0.969	Phospholipase C, zeta 1
11	9555.ENSPANP00000004862	0.969	Phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit alpha
12	9555.ENSPANP00000007984	0.969	Phospholipase C, delta 4
13	9555.ENSPANP00000010241	0.969	Phospholipase C, gamma 2 (phosphatidylinositol-specific)
14	9555.ENSPANP00000012186	0.969	Phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit gamma
15	9555.ENSPANP00000019099	0.969	Talin 1
16	9555.ENSPANP00000020671	0.969	Phospholipase C, epsilon 1
17	9555.ENSPANP00000017732	0.968	Mediates the production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3). Plays an important role in the regulation of intracellular signaling cascades.
18	9555.ENSPANP00000008176	0.967	Phospholipase C, beta 3 (phosphatidylinositol-specific)
19	9555.ENSPANP00000016326	0.966	The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes.
20	9555.ENSPANP00000017050	0.966	Phospholipase C, beta 1 (phosphoinositide-specific)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016308	1.000	1-phosphatidylinositol-4-phosphate 5-kinase activity
GO:0052813	0.661	phosphatidylinositol bisphosphate kinase activity
GO:0052812	0.382	phosphatidylinositol-3,4-bisphosphate 5-kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.998	cellular metabolic process
GO:0006796	0.994	phosphate-containing compound metabolic process
GO:0071704	0.986	organic substance metabolic process
GO:0044238	0.985	primary metabolic process
GO:0006629	0.975	lipid metabolic process
GO:0046486	0.972	glycerolipid metabolic process
GO:0006644	0.959	phospholipid metabolic process
GO:0046488	0.949	phosphatidylinositol metabolic process
GO:0065007	0.922	biological regulation
GO:0090407	0.816	organophosphate biosynthetic process
GO:0050789	0.807	regulation of biological process
GO:0050794	0.797	regulation of cellular process
GO:0045017	0.797	glycerolipid biosynthetic process
GO:0006661	0.784	phosphatidylinositol biosynthetic process
GO:0051179	0.583	localization
GO:0050896	0.406	response to stimulus
GO:0065008	0.358	regulation of biological quality
GO:0032501	0.315	multicellular organismal process
GO:0007154	0.315	cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.998	membrane
GO:0043226	0.997	organelle
GO:0030054	0.997	cell junction
GO:0005829	0.997	cytosol
GO:0005886	0.992	plasma membrane
GO:0043227	0.987	membrane-bounded organelle
GO:0043229	0.986	intracellular organelle
GO:0045202	0.980	synapse
GO:0012505	0.978	endomembrane system
GO:0005634	0.961	nucleus
GO:0031982	0.897	vesicle
GO:0031090	0.870	organelle membrane
GO:0031410	0.863	cytoplasmic vesicle
GO:0042995	0.862	cell projection
GO:0120025	0.845	plasma membrane bounded cell projection
GO:0031974	0.768	membrane-enclosed lumen
GO:0098588	0.736	bounding membrane of organelle
GO:0070161	0.694	anchoring junction
GO:0070013	0.670	intracellular organelle lumen
GO:0031981	0.660	nuclear lumen
GO:0005654	0.620	nucleoplasm
GO:0098590	0.614	plasma membrane region
GO:0031252	0.446	cell leading edge
GO:0032991	0.364	protein-containing complex
GO:0098793	0.364	presynapse
GO:0005925	0.329	focal adhesion
GO:0043232	0.329	intracellular non-membrane-bounded organelle
GO:0098794	0.321	postsynapse
GO:0098978	0.319	glutamatergic synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:14425	1.000	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol 4-phosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ADP + H(+)
EC:2.7.1.68	1.000	1-phosphatidylinositol-4-phosphate 5-kinase.
EC:2.7.1.153	0.382	phosphatidylinositol-4,5-bisphosphate 3-kinase.

[back to server]