StarFunc result for job id O60333

User Input

>input (1816 residues)
MSGASVKVAVRVRPFNSRETSKESKCIIQMQGNSTSIINPKNPKEAPKSFSFDYSYWSHT
SPEDPCFASQNRVYNDIGKEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGKQEESQAGIIP
QLCEELFEKINDNCNEEMSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVED
LSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQKKHDNETNLSTEK
VSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVDNCTSKSKKKKK
TDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIKCNAVI
NEDPNAKLVRELKEEVTRLKDLLRAQGLGDIIDIDPLIDDYSGSGSKYLKDFQNNKHRYL
LASENQRPGHFSTASMGSLTSSPSSCSLSSQVGLTSVTSIQERIMSTPGGEEAIERLKES
EKIIAELNETWEEKLRKTEAIRMEREALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNED
PLMSECLLYYIKDGITRVGQADAERRQDIVLSGAHIKEEHCIFRSERSNSGEVIVTLEPC
ERSETYVNGKRVSQPVQLRSGNRIIMGKNHVFRFNHPEQARAEREKTPSAETPSEPVDWT
FAQRELLEKQGIDMKQEMEKRLQEMEILYKKEKEEADLLLEQQRLDYESKLQALQKQVET
RSLAAETTEEEEEEEEVPWTQHEFELAQWAFRKWKSHQFTSLRDLLWGNAVYLKEANAIS
VELKKKVQFQFVLLTDTLYSPLPPELLPTEMEKTHEDRPFPRTVVAVEVQDLKNGATHYW
SLEKLKQRLDLMREMYDRAGEMASSAQDESETTVTGSDPFYDRFHWFKLVGSSPIFHGCV
NERLADRTPSPTFSTADSDITELADEQQDEMEDFDDEAFVDDAGSDAGTEEGSDLFSDGH
DPFYDRSPWFILVGRAFVYLSNLLYPVPLIHRVAIVSEKGEVRGFLRVAVQAIAADEEAP
DYGSGIRQSGTAKISFDNEYFNQSDFSSVAMTRSGLSLEELRIVEGQGQSSEVITPPEEI
SRINDLDLKSSTLLDGKMVMEGFSEEIGNHLKLGSAFTFRVTVLQASGILPEYADIFCQF
NFLHRHDEAFSTEPLKNNGRGSPLAFYHVQNIAVEITESFVDYIKTKPIVFEVFGHYQQH
PLHLQGQELNSPPQPCRRFFPPPMPLSKPVPATKLNTMSKTSLGQSMSKYDLLVWFEISE
LEPTGEYIPAVVDHTAGLPCQGTFLLHQGIQRRITVTIIHEKGSELHWKDVRELVVGRIR
NKPEVDEAAVDAILSLNIISAKYLKSSHNSSRTFYRFEAVWDSSLHNSLLLNRVTPYGEK
IYMTLSAYLELDHCIQPAVITKDVCMVFYSRDAKISPPRSLRSLFGSGYSKSPDSNRVTG
IYELSLCKMSDTGSPGMQRRRRKILDTSVAYVRGEENLAGWRPRGDSLILEHQWELEKLE
LLHEVEKTRHFLLLRERLGDSIPKSLSDSLSPSLSSGTLSTSTSISSQISTTTFESAITP
SESSGYDSGDIESLVDREKELATKCLQLLTHTFNREFSQVHGSVSDCKLSDISPIGRDPS
ESSFSSATLTPSSTCPSLVDSRSNSLDQKTPEANSRASSPCPEFEQFQIVPAVETPYLAR
AGKNEFLNLVPDIEEIRPSSVVSKKGYLHFKEPLYSNWAKHFVVVRRPYVFIYNSDKDPV
ERGIINLSTAQVEYSEDQQAMVKTPNTFAVCTKHRGVLLQALNDKDMNDWLYAFNPLLAG
TIRSKLSRRCPSQSKY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A1ZAJ2	0.389	0.411	0.000	1670	0.532	0.579	A1ZAJ2.pdb.gz	KIF1A_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=unc-104 PE=1 SV=1
2	AFDB:F1M4A4	0.447	0.471	0.000	1707	0.682	0.726	F1M4A4.pdb.gz	KIF1A_RAT Kinesin-like protein KIF1A OS=Rattus norvegicus OX=10116 GN=Kif1a PE=1 SV=3
3	AFDB:O60333	1.000	1.000	0.000	1816	1.000	1.000	O60333.pdb.gz	KIF1B_HUMAN Kinesin-like protein KIF1B OS=Homo sapiens OX=9606 GN=KIF1B PE=1 SV=5
4	AFDB:P23678	0.333	0.375	0.000	1584	0.474	0.544	P23678.pdb.gz	UN104_CAEEL Kinesin-like protein unc-104 OS=Caenorhabditis elegans OX=6239 GN=unc-104 PE=1 SV=4
5	AFDB:O43896	0.202	0.329	2.000E-92	1103	0.309	0.509	O43896.pdb.gz	KIF1C_HUMAN Kinesin-like protein KIF1C OS=Homo sapiens OX=9606 GN=KIF1C PE=1 SV=3
6	AFDB:Q9NGQ2	0.196	0.164	9.560E-85	2205	0.300	0.247	Q9NGQ2.pdb.gz	KIF1_DICDI Kinesin-related protein 1 OS=Dictyostelium discoideum OX=44689 GN=kif1 PE=1 SV=1
7	AFDB:G5EFQ4	0.192	0.367	8.681E-69	928	0.175	0.342	G5EFQ4.pdb.gz	G5EFQ4_CAEEL Kinesin-like protein OS=Caenorhabditis elegans OX=6239 GN=klp-6 PE=1 SV=1
8	AFDB:B1AVY7	0.216	0.295	8.632E-67	1312	0.183	0.253	B1AVY7.pdb.gz	KI16B_MOUSE Kinesin-like protein KIF16B OS=Mus musculus OX=10090 GN=Kif16b PE=1 SV=1
9	AFDB:Q96L93	0.216	0.294	1.435E-65	1317	0.180	0.248	Q96L93.pdb.gz	KI16B_HUMAN Kinesin-like protein KIF16B OS=Homo sapiens OX=9606 GN=KIF16B PE=1 SV=2
10	AFDB:Q15058	0.210	0.231	4.417E-65	1648	0.181	0.200	Q15058.pdb.gz	KIF14_HUMAN Kinesin-like protein KIF14 OS=Homo sapiens OX=9606 GN=KIF14 PE=1 SV=1
11	PDB:7wrgA	0.184	0.403	1.094E-62	812	0.171	0.383	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
12	PDB:7wrgB	0.178	0.404	5.907E-62	783	0.170	0.395	7wrgB.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
13	PDB:4h1gA	0.153	0.401	1.713E-22	670	0.058	0.158	4h1gA.pdb.gz	Crystal structure of the Candida albicans Kar3 kinesin motor domain fused to maltose-binding protein.
14	PDB:2ff4A	0.049	0.222	1.813E-6	379	0.017	0.082	2ff4A.pdb.gz	Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis.
15	PDB:7dvqX	0.053	0.542	2.335E-5	156	0.013	0.154	7dvqX.pdb.gz	Structure of the activated human minor spliceosome.
16	PDB:3ljuX	0.047	0.218	7.187E-5	373	0.009	0.043	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
17	PDB:7rx9A	0.052	0.203	1.397E-4	432	0.011	0.046	7rx9A.pdb.gz
18	PDB:5gm6U	0.056	0.503	2.102E-4	176	0.013	0.136	5gm6U.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
19	PDB:6bbpA	0.050	0.167	1.708E-3	520	0.009	0.033	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
20	PDB:4mt6A	0.049	0.211	3.870E-3	389	0.010	0.046	4mt6A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A6V5	0.0	1115	1697	0.312	0.334	A0A8I6A6V5_RAT Kinesin family member 1A OS=Rattus norvegicus OX=10116 GN=Kif1a PE=1 SV=1
2	A1ZAJ2	0.0	1082	1670	0.311	0.338	KIF1A_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=unc-104 PE=1 SV=1
3	E9QDE5	0.0	3083	1763	0.853	0.879	E9QDE5_DANRE Kinesin family member 1B OS=Danio rerio OX=7955 GN=unm_st43 PE=1 SV=1
4	F1M4A4	0.0	1112	1707	0.312	0.332	KIF1A_RAT Kinesin-like protein KIF1A OS=Rattus norvegicus OX=10116 GN=Kif1a PE=1 SV=3
5	F1QBV5	0.0	3091	1770	0.854	0.876	F1QBV5_DANRE Kinesin family member 1B OS=Danio rerio OX=7955 GN=unm_st43 PE=1 SV=1
6	F1QJ64	0.0	1260	1161	0.344	0.538	F1QJ64_DANRE Kinesin family member 1B OS=Danio rerio OX=7955 GN=unm_st43 PE=1 SV=1
7	O35071	0.0	999	1100	0.280	0.462	KIF1C_MOUSE Kinesin-like protein KIF1C OS=Mus musculus OX=10090 GN=Kif1c PE=1 SV=2
8	O35787	0.0	952	1097	0.271	0.449	KIF1C_RAT Kinesin-like protein KIF1C OS=Rattus norvegicus OX=10116 GN=Kif1c PE=1 SV=1
9	O43896	0.0	999	1103	0.279	0.459	KIF1C_HUMAN Kinesin-like protein KIF1C OS=Homo sapiens OX=9606 GN=KIF1C PE=1 SV=3
10	O60333	0.0	3771	1816	1.000	1.000	KIF1B_HUMAN Kinesin-like protein KIF1B OS=Homo sapiens OX=9606 GN=KIF1B PE=1 SV=5
11	O88658	0.0	3673	1816	0.968	0.968	KIF1B_RAT Kinesin-like protein KIF1B OS=Rattus norvegicus OX=10116 GN=Kif1b PE=1 SV=2
12	P23678	0.0	927	1584	0.276	0.317	UN104_CAEEL Kinesin-like protein unc-104 OS=Caenorhabditis elegans OX=6239 GN=unc-104 PE=1 SV=4
13	P33173	0.0	1102	1695	0.311	0.333	KIF1A_MOUSE Kinesin-like protein KIF1A OS=Mus musculus OX=10090 GN=Kif1a PE=1 SV=2
14	Q12756	0.0	1113	1690	0.309	0.333	KIF1A_HUMAN Kinesin-like protein KIF1A OS=Homo sapiens OX=9606 GN=KIF1A PE=1 SV=2
15	Q60575	0.0	3685	1816	0.970	0.970	KIF1B_MOUSE Kinesin-like protein KIF1B OS=Mus musculus OX=10090 GN=Kif1b PE=1 SV=2
16	Q9NGQ2	0.0	643	2205	0.226	0.186	KIF1_DICDI Kinesin-related protein 1 OS=Dictyostelium discoideum OX=44689 GN=kif1 PE=1 SV=1
17	Q5AVY3	1.21e-143	488	1630	0.132	0.147	Q5AVY3_EMENI Kinesin family protein (AFU_orthologue AFUA_2G14730) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=uncA PE=3 SV=1
18	Q9VB25	4.51e-140	471	1265	0.150	0.215	KL98A_DROME Kinesin-like protein Klp98A OS=Drosophila melanogaster OX=7227 GN=Klp98A PE=1 SV=2
19	A0A0B4LGK5	3.35e-135	468	1913	0.132	0.125	A0A0B4LGK5_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=Khc-73 PE=1 SV=1
20	A4UZI0	3.55e-135	468	1899	0.132	0.126	A4UZI0_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=Khc-73 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12473 DUF3694	2.5e-38	143.4	Kinesin protein
2	PF00498 FHA	0.00012	33.6	FHA domain
3	PF12423 KIF1B	1e-13	62.6	Kinesin protein 1B
4	PF00225 Kinesin	8.3e-113	388.3	Kinesin motor domain
5	PF16183 Kinesin_assoc	1.4e-82	287.7	Kinesin-associated
6	PF16796 Microtub_bd	1e-19	82.4	Microtubule binding
7	PF00169 PH	2.4e-09	49.0	PH domain
8	PF14593 PH_3	1.7e+02	13.6	PH domain
9	PF16697 Yop-YscD_cpl	4.7	18.9	Inner membrane component of T3SS, cytoplasmic domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000017229

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000015755	0.778	Plays a role in cytokinesis. Displays serine/threonine protein kinase activity
2	60711.ENSCSAP00000008237	0.758	Discs, large homolog 4 (Drosophila)
3	60711.ENSCSAP00000011643	0.721	Dynactin 1
4	60711.ENSCSAP00000007656	0.701	Kinesin-associated protein 3
5	60711.ENSCSAP00000006701	0.668	Ubiquitin-like domain containing CTD phosphatase 1
6	60711.ENSCSAP00000014926	0.660	Chloride channel, voltage-sensitive 3
7	60711.ENSCSAP00000006160	0.647	Uncharacterized protein
8	60711.ENSCSAP00000007804	0.643	Kinesin light chain 4
9	60711.ENSCSAP00000002301	0.630	Rac GTPase activating protein 1
10	60711.ENSCSAP00000003809	0.627	Neuroblastoma amplified sequence
11	60711.ENSCSAP00000012208	0.621	Neurofilament, light polypeptide
12	60711.ENSCSAP00000007803	0.619	Kinesin-like protein
13	60711.ENSCSAP00000002839	0.617	Kinesin family member 11
14	60711.ENSCSAP00000004400	0.617	Kinesin light chain 2
15	60711.ENSCSAP00000012096	0.616	Kinesin-like protein
16	60711.ENSCSAP00000001073	0.615	Kinesin-like protein
17	60711.ENSCSAP00000005800	0.615	BCL2/adenovirus E1B 19kDa interacting protein 1
18	60711.ENSCSAP00000012514	0.609	Kinesin family member 15
19	60711.ENSCSAP00000009387	0.606	Kinesin-like protein
20	60711.ENSCSAP00000004044	0.602	KIF1 binding protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003774	0.999	cytoskeletal motor activity
GO:0008092	0.999	cytoskeletal protein binding
GO:0003777	0.965	microtubule motor activity
GO:0015631	0.914	tubulin binding
GO:0019894	0.858	kinesin binding
GO:0008017	0.833	microtubule binding
GO:0008574	0.671	plus-end-directed microtubule motor activity
GO:0003824	0.361	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0008088	0.989	axo-dendritic transport
GO:0098930	0.966	axonal transport
GO:0072384	0.606	organelle transport along microtubule
GO:0008089	0.555	anterograde axonal transport
GO:0050896	0.361	response to stimulus
GO:0070727	0.318	cellular macromolecule localization
GO:0071840	0.317	cellular component organization or biogenesis
GO:0042221	0.315	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0016020	0.995	membrane
GO:0031982	0.986	vesicle
GO:0032991	0.984	protein-containing complex
GO:0097708	0.977	intracellular vesicle
GO:0031410	0.970	cytoplasmic vesicle
GO:0043232	0.969	intracellular non-membrane-bounded organelle
GO:0015630	0.851	microtubule cytoskeleton
GO:0043005	0.720	neuron projection
GO:0005875	0.718	microtubule associated complex
GO:0005739	0.690	mitochondrion
GO:0031090	0.373	organelle membrane
GO:0005829	0.359	cytosol
GO:0030424	0.333	axon

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.1.3	0.671	plus-end-directed kinesin ATPase.

[back to server]