StarFunc result for job id O60336

User Input

>input (1514 residues)
MAVEGSTITSRIKNLLRSPSIKLRRSKAGNRREDLSSKVTLEKVLGITVSGGRGLACDPR
SGLVAYPAGCVVVLFNPRKHKQHHILNSSRKTITALAFSPDGKYLVTGESGHMPAVRVWD
VAEHSQVAELQEHKYGVACVAFSPSAKYIVSVGYQHDMIVNVWAWKKNIVVASNKVSSRV
TAVSFSEDCSYFVTAGNRHIKFWYLDDSKTSKVNATVPLLGRSGLLGELRNNLFTDVACG
RGKKADSTFCITSSGLLCEFSDRRLLDKWVELRNIDSFTTTVAHCISVSQDYIFCGCADG
TVRLFNPSNLHFLSTLPRPHALGTDIASVTEASRLFSGVANARYPDTIALTFDPTNQWLS
CVYNDHSIYVWDVRDPKKVGKVYSALYHSSCVWSVEVYPEVKDSNQACLPPSSFITCSSD
NTIRLWNTESSGVHGSTLHRNILSSDLIKIIYVDGNTQALLDTELPGGDKADASLLDPRV
GIRSVCVSPNGQHLASGDRMGTLRVHELQSLSEMLKVEAHDSEILCLEYSKPDTGLKLLA
SASRDRLIHVLDAGREYSLQQTLDEHSSSITAVKFAASDGQVRMISCGADKSIYFRTAQK
SGDGVQFTRTHHVVRKTTLYDMDVEPSWKYTAIGCQDRNIRIFNISSGKQKKLFKGSQGE
DGTLIKVQTDPSGIYIATSCSDKNLSIFDFSSGECVATMFGHSEIVTGMKFSNDCKHLIS
VSGDSCIFVWRLSSEMTISMRQRLAELRQRQRGGKQQGPSSPQRASGPNRHQAPSMLSPG
PALSSDSDKEGEDEGTEEELPALPVLAKSTKKALASVPSPALPRSLSHWEMSRAQESVGF
LDPAPAANPGPRRRGRWVQPGVELSVRSMLDLRQLETLAPSLQDPSQDSLAIIPSGPRKH
GQEALETSLTSQNEKPPRPQASQPCSYPHIIRLLSQEEGVFAQDLEPAPIEDGIVYPEPS
DNPTMDTSEFQVQAPARGTLGRVYPGSRSSEKHSPDSACSVDYSSSCLSSPEHPTEDSES
TEPLSVDGISSDLEEPAEGDEEEEEEEGGMGPYGLQEGSPQTPDQEQFLKQHFETLASGA
APGAPVQVPERSESRSISSRFLLQVQTRPLREPSPSSSSLALMSRPAQVPQASGEQPRGN
GANPPGAPPEVEPSSGNPSPQQAASVLLPRCRLNPDSSWAPKRVATASPFSGLQKAQSVH
SLVPQERHEASLQAPSPGALLSREIEAQDGLGSLPPADGRPSRPHSYQNPTTSSMAKISR
SISVGENLGLVAEPQAHAPIRVSPLSKLALPSRAHLVLDIPKPLPDRPTLAAFSPVTKGR
APGEAEKPGFPVGLGKAHSTTERWACLGEGTTPKPRTECQAHPGPSSPCAQQLPVSSLFQ
GPENLQPPPPEKTPNPMECTKPGAALSQDSEPAVSLEQCEQLVAELRGSVRQAVRLYHSV
AGCKMPSAEQSRIAQLLRDTFSSVRQELEAVAGAVLSSPGSSPGAVGAEQTQALLEQYSE
LLLRAVERRMERKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1LRR4	0.475	0.465	0.000	1551	0.397	0.387	F1LRR4.pdb.gz	F1LRR4_RAT WD repeat domain 62 OS=Rattus norvegicus OX=10116 GN=Wdr62 PE=1 SV=4
2	AFDB:O43379	0.486	0.485	0.000	1518	0.398	0.397	O43379.pdb.gz	WDR62_HUMAN WD repeat-containing protein 62 OS=Homo sapiens OX=9606 GN=WDR62 PE=1 SV=4
3	AFDB:O60336	1.000	1.000	0.000	1514	1.000	1.000	O60336.pdb.gz	MABP1_HUMAN Mitogen-activated protein kinase-binding protein 1 OS=Homo sapiens OX=9606 GN=MAPKBP1 PE=1 SV=4
4	AFDB:M9PB01	0.463	0.294	5.109E-101	2397	0.323	0.204	M9PB01.pdb.gz	M9PB01_DROME WD repeat domain 62, isoform G OS=Drosophila melanogaster OX=7227 GN=Wdr62 PE=4 SV=1
5	PDB:7rroe	0.364	0.858	2.859E-33	610	0.081	0.202	7rroe.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
6	PDB:7mq8LR	0.287	0.486	1.690E-32	773	0.078	0.153	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
7	PDB:7mq8LO	0.327	0.547	1.288E-31	848	0.059	0.105	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
8	PDB:7mqaLO	0.331	0.576	5.614E-31	819	0.061	0.112	7mqaLO.pdb.gz	Nucleolar maturation of the human small subunit processome.
9	PDB:6lqsB1	0.330	0.579	1.473E-30	806	0.067	0.125	6lqsB1.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
10	PDB:7mqaLQ	0.299	0.500	1.630E-30	830	0.069	0.125	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
11	PDB:7ajtUA	0.320	0.542	3.993E-29	834	0.063	0.115	7ajtUA.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
12	PDB:1nr0A	0.336	0.768	1.740E-28	610	0.063	0.156	1nr0A.pdb.gz
13	PDB:7ajuUL	0.296	0.520	4.126E-28	779	0.074	0.144	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
14	PDB:7ajtUM	0.281	0.487	4.634E-26	762	0.068	0.135	7ajtUM.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
15	AFDB:A0A0B4KI44	0.172	0.182	2.341E-10	1433	0.106	0.112	A0A0B4KI44.pdb.gz	A0A0B4KI44_DROME Tusp, isoform F OS=Drosophila melanogaster OX=7227 GN=Tusp PE=3 SV=1
16	AFDB:Q9VC96	0.145	0.104	5.351E-8	2232	0.136	0.092	Q9VC96.pdb.gz	Q9VC96_DROME BRWD3 OS=Drosophila melanogaster OX=7227 GN=BRWD3 PE=1 SV=2
17	AFDB:Q921C3	0.178	0.121	3.163E-7	2304	0.127	0.084	Q921C3.pdb.gz	BRWD1_MOUSE Bromodomain and WD repeat-containing protein 1 OS=Mus musculus OX=10090 GN=Brwd1 PE=1 SV=2
18	AFDB:Q3MHU0	0.049	0.095	2.668E-6	740	0.122	0.249	Q3MHU0.pdb.gz	Q3MHU0_RAT Wdr62 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Wdr62 PE=2 SV=1
19	AFDB:Q17602	0.113	0.120	1.354E-5	1390	0.120	0.130	Q17602.pdb.gz	NU214_CAEEL Nuclear pore complex protein 14 OS=Caenorhabditis elegans OX=6239 GN=npp-14 PE=1 SV=1
20	AFDB:Q54PV1	0.080	0.072	7.609E-5	1800	0.104	0.087	Q54PV1.pdb.gz	Q54PV1_DICDI Inositol 5-phosphatase OS=Dictyostelium discoideum OX=44689 GN=Dd5P2 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K8E8	0.0	862	1505	0.269	0.271	A0A0G2K8E8_RAT WD repeat domain 62 OS=Rattus norvegicus OX=10116 GN=Wdr62 PE=1 SV=2
2	A8DYT1	0.0	783	1539	0.269	0.264	A8DYT1_DROME WD repeat domain 62, isoform D OS=Drosophila melanogaster OX=7227 GN=Wdr62 PE=4 SV=1
3	M9NE65	0.0	783	1554	0.269	0.262	M9NE65_DROME WD repeat domain 62, isoform F OS=Drosophila melanogaster OX=7227 GN=Wdr62 PE=4 SV=1
4	M9PB01	0.0	786	2397	0.266	0.168	M9PB01_DROME WD repeat domain 62, isoform G OS=Drosophila melanogaster OX=7227 GN=Wdr62 PE=4 SV=1
5	M9PBP2	0.0	784	1476	0.271	0.278	M9PBP2_DROME WD repeat domain 62, isoform H OS=Drosophila melanogaster OX=7227 GN=Wdr62 PE=4 SV=1
6	O43379	0.0	985	1518	0.297	0.296	WDR62_HUMAN WD repeat-containing protein 62 OS=Homo sapiens OX=9606 GN=WDR62 PE=1 SV=4
7	O60336	0.0	3100	1514	1.000	1.000	MABP1_HUMAN Mitogen-activated protein kinase-binding protein 1 OS=Homo sapiens OX=9606 GN=MAPKBP1 PE=1 SV=4
8	Q0E8U6	0.0	782	1504	0.269	0.271	Q0E8U6_DROME RE21455p OS=Drosophila melanogaster OX=7227 GN=Wdr62 PE=2 SV=1
9	Q0E8U7	0.0	785	2347	0.266	0.172	Q0E8U7_DROME WD repeat domain 62, isoform C OS=Drosophila melanogaster OX=7227 GN=Wdr62 PE=4 SV=1
10	Q6NS57	0.0	2568	1503	0.852	0.858	MABP1_MOUSE Mitogen-activated protein kinase-binding protein 1 OS=Mus musculus OX=10090 GN=Mapkbp1 PE=1 SV=1
11	Q9VQ54	0.0	785	1508	0.271	0.272	Q9VQ54_DROME FI05392p OS=Drosophila melanogaster OX=7227 GN=Wdr62 PE=2 SV=2
12	Q960J6	1.21e-135	451	1183	0.161	0.205	Q960J6_DROME LD47622p OS=Drosophila melanogaster OX=7227 GN=Wdr62 PE=2 SV=1
13	D6QUQ2	2.58e-14	79.7	463	0.050	0.164	D6QUQ2_9CNID Poc1 OS=Clytia hemisphaerica OX=252671 PE=2 SV=1
14	F1SS88	3.58e-14	80.1	620	0.037	0.090	CFA52_PIG Cilia- and flagella-associated protein 52 OS=Sus scrofa OX=9823 GN=CFAP52 PE=1 SV=3
15	Q05BV3	6.47e-14	80.1	1969	0.043	0.033	EMAL5_HUMAN Echinoderm microtubule-associated protein-like 5 OS=Homo sapiens OX=9606 GN=EML5 PE=2 SV=3
16	A0A0G2JZG6	1.24e-13	79.0	1526	0.098	0.097	A0A0G2JZG6_RAT WD repeat domain 62 OS=Rattus norvegicus OX=10116 GN=Wdr62 PE=1 SV=1
17	Q8N136	1.41e-13	77.0	415	0.059	0.214	DAW1_HUMAN Dynein assembly factor with WD repeat domains 1 OS=Homo sapiens OX=9606 GN=DAW1 PE=1 SV=1
18	Q8TC44	1.55e-13	77.4	478	0.046	0.144	POC1B_HUMAN POC1 centriolar protein homolog B OS=Homo sapiens OX=9606 GN=POC1B PE=1 SV=1
19	F1M5K2	1.73e-13	78.6	1551	0.098	0.095	F1M5K2_RAT WD repeat domain 62 OS=Rattus norvegicus OX=10116 GN=Wdr62 PE=1 SV=2
20	F1LRR4	2.07e-13	78.2	1541	0.098	0.096	F1LRR4_RAT WD repeat domain 62 OS=Rattus norvegicus OX=10116 GN=Wdr62 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	1.6e-09	49.3	Anaphase-promoting complex subunit 4 WD40 domain
2	PF08662 eIF2A	0.15	23.5	Eukaryotic translation initiation factor eIF2A
3	PF20426 NBCH_WD40	17	15.8	Neurobeachin beta propeller domain
4	PF11715 Nup160	3.4e+02	11.3	Nucleoporin Nup120/160
5	PF00400 WD40	2.4e-34	128.0	WD domain, G-beta repeat
6	PF17005 WD40_like	5	18.0	WD40-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000393099

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355500	0.680	Centrosomal protein of 170 kDa
2	9606.ENSP00000297837	0.679	Ankyrin repeat and SAM domain-containing protein 6
3	9606.ENSP00000327255	0.664	Protein phosphatase 1A
4	9606.ENSP00000371308	0.654	Centromere protein J
5	9606.ENSP00000343818	0.641	CDK5 regulatory subunit-associated protein 2
6	9606.ENSP00000247668	0.634	TNF receptor-associated factor 2
7	9606.ENSP00000370337	0.618	Centrosomal protein of 152 kDa
8	9606.ENSP00000394560	0.604	Mitogen-activated protein kinase 9
9	9606.ENSP00000378974	0.595	Mitogen-activated protein kinase 8
10	9606.ENSP00000335463	0.591	Kinetochore scaffold 1
11	9606.ENSP00000323288	0.575	RNA pseudouridylate synthase domain containing 2
12	9606.ENSP00000356379	0.558	Abnormal spindle-like microcephaly-associated protein
13	9606.ENSP00000356785	0.503	Nucleoside diphosphate kinase 7
14	9606.ENSP00000449381	0.502	MAP kinase-activated protein kinase 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0048583	0.984	regulation of response to stimulus
GO:0023051	0.968	regulation of signaling
GO:0010646	0.967	regulation of cell communication
GO:0080134	0.966	regulation of response to stress
GO:0048518	0.911	positive regulation of biological process
GO:1902531	0.902	regulation of intracellular signal transduction
GO:1902533	0.880	positive regulation of intracellular signal transduction
GO:0009987	0.832	cellular process
GO:0019222	0.811	regulation of metabolic process
GO:0060255	0.784	regulation of macromolecule metabolic process
GO:0010468	0.766	regulation of gene expression
GO:0051239	0.635	regulation of multicellular organismal process
GO:0001817	0.519	regulation of cytokine production
GO:0048519	0.504	negative regulation of biological process
GO:0048523	0.413	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0005737	0.996	cytoplasm
GO:0005819	0.995	spindle
GO:0005829	0.967	cytosol
GO:0000922	0.916	spindle pole
GO:0072686	0.859	mitotic spindle
GO:0005815	0.800	microtubule organizing center
GO:0005813	0.645	centrosome
GO:0097431	0.491	mitotic spindle pole
GO:0005730	0.345	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]