StarFunc result for job id O60343

User Input

>input (1298 residues)
MEPPSCIQDEPFPHPLEPEPGVSAQPGPGKPSDKRFRLWYVGGSCLDHRTTLPMLPWLMA
EIRRRSQKPEAGGCGAPAAREVILVLSAPFLRCVPAPGAGASGGTSPSATQPNPAVFIFE
HKAQHISRFIHNSHDLTYFAYLIKAQPDDPESQMACHVFRATDPSQVPDVISSIRQLSKA
AMKEDAKPSKDNEDAFYNSQKFEVLYCGKVTVTHKKAPSSLIDDCMEKFSLHEQQRLKIQ
GEQRGPDPGEDLADLEVVVPGSPGDCLPEEADGTDTHLGLPAGASQPALTSSRVCFPERI
LEDSGFDEQQEFRSRCSSVTGVQRRVHEGSQKSQPRRRHASAPSHVQPSDSEKNRTMLFQ
VGRFEINLISPDTKSVVLEKNFKDISSCSQGIKHVDHFGFICRESPEPGLSQYICYVFQC
ASESLVDEVMLTLKQAFSTAAALQSAKTQIKLCEACPMHSLHKLCERIEGLYPPRAKLVI
QRHLSSLTDNEQADIFERVQKMKPVSDQEENELVILHLRQLCEAKQKTHVHIGEGPSTIS
NSTIPENATSSGRFKLDILKNKAKRSLTSSLENIFSRGANRMRGRLGSVDSFERSNSLAS
EKDYSPGDSPPGTPPASPPSSAWQTFPEEDSDSPQFRRRAHTFSHPPSSTKRKLNLQDGR
AQGVRSPLLRQSSSEQCSNLSSVRRMYKESNSSSSLPSLHTSFSAPSFTAPSFLKSFYQN
SGRLSPQYENEIRQDTASESSDGEGRKRTSSTCSNESLSVGGTSVTPRRISWRQRIFLRV
ASPMNKSPSAMQQQDGLDRNELLPLSPLSPTMEEEPLVVFLSGEDDPEKIEERKKSKELR
SLWRKAIHQQILLLRMEKENQKLEASRDELQSRKVKLDYEEVGACQKEVLITWDKKLLNC
RAKIRCDMEDIHTLLKEGVPKSRRGEIWQFLALQYRLRHRLPNKQQPPDISYKELLKQLT
AQQHAILVDLGRTFPTHPYFSVQLGPGQLSLFNLLKAYSLLDKEVGYCQGISFVAGVLLL
HMSEEQAFEMLKFLMYDLGFRKQYRPDMMSLQIQMYQLSRLLHDYHRDLYNHLEENEISP
SLYAAPWFLTLFASQFSLGFVARVFDIIFLQGTEVIFKVALSLLSSQETLIMECESFENI
VEFLKNTLPDMNTSEMEKIITQVFEMDISKQLHAYEVEYHVLQDELQESSYSCEDSETLE
KLERANSQLKRQNMDLLEKLQVAHTKIQALESNLENLLTRETKMKSLIRTLEQEKMAYQK
TVEQLRKLLPADALVNCDLLLRDLNCNPNNKAKIGNKP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3Z881	0.397	0.412	0.000	1245	0.854	0.891	D3Z881.pdb.gz	D3Z881_RAT TBC1 domain family, member 4 OS=Rattus norvegicus OX=10116 GN=Tbc1d4 PE=1 SV=4
2	AFDB:D3ZGN0	0.357	0.354	0.000	1309	0.898	0.891	D3ZGN0.pdb.gz	D3ZGN0_RAT TBC1 domain family, member 4 OS=Rattus norvegicus OX=10116 GN=Tbc1d4 PE=1 SV=4
3	AFDB:H2KZZ6	0.224	0.308	2.520E-21	934	0.149	0.207	H2KZZ6.pdb.gz	TBC11_CAEEL Rab GTPase-activating protein tbc-11 OS=Caenorhabditis elegans OX=6239 GN=tbc-11 PE=1 SV=1
4	AFDB:Q9VYY9	0.226	0.358	1.546E-20	807	0.096	0.155	Q9VYY9.pdb.gz	EVI5_DROME Ecotropic viral integration site 5 ortholog OS=Drosophila melanogaster OX=7227 GN=Evi5 PE=1 SV=3
5	AFDB:O60447	0.227	0.358	3.736E-18	810	0.105	0.168	O60447.pdb.gz	EVI5_HUMAN Ecotropic viral integration site 5 protein homolog OS=Homo sapiens OX=9606 GN=EVI5 PE=1 SV=3
6	AFDB:Q96CN4	0.227	0.363	1.733E-17	794	0.103	0.169	Q96CN4.pdb.gz	EVI5L_HUMAN EVI5-like protein OS=Homo sapiens OX=9606 GN=EVI5L PE=1 SV=1
7	AFDB:Q9UPU7	0.210	0.278	6.367E-15	963	0.111	0.150	Q9UPU7.pdb.gz	TBD2B_HUMAN TBC1 domain family member 2B OS=Homo sapiens OX=9606 GN=TBC1D2B PE=1 SV=2
8	AFDB:Q8STF6	0.100	0.142	8.191E-8	887	0.102	0.149	Q8STF6.pdb.gz	DYC1_CAEEL Dystrophin-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=dyc-1 PE=1 SV=1
9	AFDB:X2JEI9	0.089	0.058	1.106E-4	2206	0.075	0.044	X2JEI9.pdb.gz	X2JEI9_DROME Rho GTPase activating protein at 19D, isoform D OS=Drosophila melanogaster OX=7227 GN=RhoGAP19D PE=1 SV=1
10	PDB:4z6yA	0.137	0.539	1.565E-4	273	0.041	0.194	4z6yA.pdb.gz
11	AFDB:O13736	0.074	0.068	2.328E-4	1420	0.085	0.077	O13736.pdb.gz	SLA1_SCHPO Actin cytoskeleton-regulatory complex protein sla1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sla1 PE=1 SV=1
12	PDB:7c3mA	0.059	0.125	2.268E-2	577	0.032	0.073	7c3mA.pdb.gz
13	PDB:7nkyQ	0.056	0.154	8.339E-2	404	0.020	0.064	7nkyQ.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
14	PDB:3m1iB	0.060	0.501	1.004E-1	131	0.007	0.069	3m1iB.pdb.gz	An allosteric mechanism to displace nuclear export cargo from CRM1 and RanGTP by RanBP1
15	PDB:3rt0C	0.041	0.141	1.391E-1	172	0.017	0.128	3rt0C.pdb.gz	The Molecular Basis of ABA-Independent Inhibition of PP2Cs by a Subclass of PYL Proteins
16	PDB:6s9wA	0.067	0.201	1.838E-1	411	0.011	0.034	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
17	PDB:1k5dB	0.072	0.484	1.926E-1	146	0.012	0.110	1k5dB.pdb.gz	RanGAP mediates GTP hydrolysis without an arginine finger.
18	PDB:5yqrA	0.050	0.215	1.926E-1	268	0.008	0.037	5yqrA.pdb.gz
19	PDB:6xtbE	0.084	0.282	1.926E-1	235	0.020	0.111	6xtbE.pdb.gz
20	PDB:3kdhA	0.043	0.150	2.018E-1	189	0.013	0.090	3kdhA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A3B3IRT3	0.0	1003	1054	0.384	0.472	A0A3B3IRT3_HUMAN TBC1 domain family member 4 OS=Homo sapiens OX=9606 GN=TBC1D4 PE=1 SV=1
2	A0A8I5ZLK4	0.0	987	1240	0.465	0.487	A0A8I5ZLK4_RAT TBC1 domain family member 1 OS=Rattus norvegicus OX=10116 GN=Tbc1d1 PE=4 SV=1
3	A0A8I5ZMX5	0.0	994	1257	0.471	0.486	A0A8I5ZMX5_RAT TBC1 domain family member 1 OS=Rattus norvegicus OX=10116 GN=Tbc1d1 PE=4 SV=1
4	A0A8I6AB45	0.0	664	1162	0.267	0.298	A0A8I6AB45_RAT TBC1 domain family member 1 OS=Rattus norvegicus OX=10116 GN=Tbc1d1 PE=4 SV=1
5	A0A8I6ABF1	0.0	2231	1286	0.883	0.891	A0A8I6ABF1_RAT TBC1 domain family, member 4 OS=Rattus norvegicus OX=10116 GN=Tbc1d4 PE=1 SV=1
6	A0A8I6AT49	0.0	2270	1300	0.896	0.895	A0A8I6AT49_RAT TBC1 domain family, member 4 OS=Rattus norvegicus OX=10116 GN=Tbc1d4 PE=1 SV=1
7	A0A8I6G5Y5	0.0	999	1202	0.467	0.504	A0A8I6G5Y5_RAT TBC1 domain family member 1 OS=Rattus norvegicus OX=10116 GN=Tbc1d1 PE=4 SV=1
8	D3Z881	0.0	1029	1245	0.395	0.412	D3Z881_RAT TBC1 domain family, member 4 OS=Rattus norvegicus OX=10116 GN=Tbc1d4 PE=1 SV=4
9	D3ZGN0	0.0	2293	1308	0.902	0.895	D3ZGN0_RAT TBC1 domain family, member 4 OS=Rattus norvegicus OX=10116 GN=Tbc1d4 PE=1 SV=4
10	D4AC16	0.0	664	1033	0.267	0.335	D4AC16_RAT TBC1 domain family member 1 OS=Rattus norvegicus OX=10116 GN=Tbc1d1 PE=1 SV=2
11	O60343	0.0	2682	1298	1.000	1.000	TBCD4_HUMAN TBC1 domain family member 4 OS=Homo sapiens OX=9606 GN=TBC1D4 PE=1 SV=2
12	Q60949	0.0	1003	1255	0.471	0.487	TBCD1_MOUSE TBC1 domain family member 1 OS=Mus musculus OX=10090 GN=Tbc1d1 PE=1 SV=3
13	Q86TI0	0.0	665	1168	0.251	0.279	TBCD1_HUMAN TBC1 domain family member 1 OS=Homo sapiens OX=9606 GN=TBC1D1 PE=1 SV=2
14	Q8BYJ6	0.0	2364	1307	0.904	0.897	TBCD4_MOUSE TBC1 domain family member 4 OS=Mus musculus OX=10090 GN=Tbc1d4 PE=1 SV=2
15	Q24193	4.06e-116	382	732	0.153	0.270	Q24193_DROME Pollux OS=Drosophila melanogaster OX=7227 GN=plx PE=2 SV=1
16	Q6AWQ6	5.43e-115	372	535	0.151	0.366	Q6AWQ6_DROME RH06321p (Fragment) OS=Drosophila melanogaster OX=7227 GN=plx PE=2 SV=1
17	Q9TY11	5.75e-114	391	1379	0.165	0.155	Q9TY11_DROME Pollux protein OS=Drosophila melanogaster OX=7227 GN=plx PE=2 SV=1
18	A0A0B4KG76	7.46e-114	390	1352	0.165	0.158	A0A0B4KG76_DROME Pollux, isoform F OS=Drosophila melanogaster OX=7227 GN=plx PE=4 SV=1
19	Q9VNG9	8.19e-114	390	1379	0.165	0.155	Q9VNG9_DROME Pollux, isoform A OS=Drosophila melanogaster OX=7227 GN=plx PE=4 SV=1
20	Q8IPP5	9.67e-114	391	1406	0.165	0.152	Q8IPP5_DROME Pollux, isoform D OS=Drosophila melanogaster OX=7227 GN=plx PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11830 DUF3350	3.2e-25	99.5	Domain of unknown function (DUF3350)
2	PF14054 DUF4249	42	15.1	Domain of unknown function (DUF4249)
3	PF00640 PID	8.3e-12	56.8	Phosphotyrosine interaction domain (PTB/PID)
4	PF00566 RabGAP-TBC	6e-48	174.9	Rab-GTPase-TBC domain
5	PF02132 RecR	2e+02	12.9	RecR protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000366863

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000320935	0.994	Solute carrier family 2, facilitated glucose transporter member 4
2	9606.ENSP00000231368	0.991	Leucyl-cystinyl aminopeptidase
3	9606.ENSP00000451828	0.987	RAC-alpha serine/threonine-protein kinase
4	9606.ENSP00000264710	0.981	Ras-related protein Rab-10
5	9606.ENSP00000362946	0.979	Ras-related protein Rab-14
6	9606.ENSP00000375892	0.977	RAC-beta serine/threonine-protein kinase
7	9606.ENSP00000300935	0.975	Ras-related protein Rab-8A
8	9606.ENSP00000379287	0.969	14-3-3 protein zeta/delta
9	9606.ENSP00000357564	0.948	Ras-related protein Rab-13
10	9606.ENSP00000361930	0.944	14-3-3 protein beta/alpha
11	9606.ENSP00000340989	0.943	14-3-3 protein sigma
12	9606.ENSP00000371267	0.939	14-3-3 protein theta
13	9606.ENSP00000314214	0.936	Vesicle-associated membrane protein 2
14	9606.ENSP00000264335	0.927	14-3-3 protein epsilon
15	9606.ENSP00000383063	0.925	Nuclear receptor-interacting protein 1
16	9606.ENSP00000248975	0.922	14-3-3 protein eta
17	9606.ENSP00000306330	0.916	14-3-3 protein gamma
18	9606.ENSP00000263826	0.873	RAC-gamma serine/threonine-protein kinase
19	9606.ENSP00000380432	0.796	Insulin
20	9606.ENSP00000304895	0.746	Insulin receptor substrate 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.367	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050896	0.994	response to stimulus
GO:0050794	0.980	regulation of cellular process
GO:0032869	0.972	cellular response to insulin stimulus
GO:0048523	0.907	negative regulation of cellular process
GO:0051049	0.879	regulation of transport
GO:0051051	0.825	negative regulation of transport
GO:0051128	0.791	regulation of cellular component organization
GO:0033043	0.739	regulation of organelle organization
GO:0031338	0.610	regulation of vesicle fusion
GO:0051179	0.500	localization
GO:0006810	0.376	transport
GO:0010639	0.362	negative regulation of organelle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031982	1.000	vesicle
GO:0005829	0.995	cytosol
GO:0016020	0.898	membrane
GO:0043231	0.838	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]