StarFunc result for job id O60346

User Input

>input (1717 residues)
MEPAAAATVQRLPELGREDRASAPAAAAAAAAAAAAAAAALAAAAGGGRSPEPALTPAAP
SGGNGSGSGAREEAPGEAPPGPLPGRAGGAGRRRRRGAPQPIAGGAAPVPGAGGGANSLL
LRRGRLKRNLSAAAAAASSSSSSSAAAASHSPGAAGLPASCSASASLCTRSLDRKTLLLK
HRQTLQLQPSDRDWVRHQLQRGCVHVFDRHMASTYLRPVLCTLDTTAGEVAARLLQLGHK
GGGVVKVLGQGPGAAAAREPAEPPPEAGPRLAPPEPRDSEVPPARSAPGAFGGPPRAPPA
DLPLPVGGPGGWSRRASPAPSDSSPGEPFVGGPVSSPRAPRPVVSDTESFSLSPSAESVS
DRLDPYSSGGGSSSSSEELEADAASAPTGVPGQPRRPGHPAQPLPLPQTASSPQPQQKAP
RAIDSPGGAVREGSCEEKAAAAVAPGGLQSTPGRSGVTAEKAPPPPPPPTLYVQLHGETT
RRLEAEEKPLQIQNDYLFQLGFGELWRVQEEGMDSEIGCLIRFYAGKPHSTGSSERIQLS
GMYNVRKGKMQLPVNRWTRRQVILCGTCLIVSSVKDSLTGKMHVLPLIGGKVEEVKKHQH
CLAFSSSGPQSQTYYICFDTFTEYLRWLRQVSKVASQRISSVDLSCCSLEHLPANLFYSQ
DLTHLNLKQNFLRQNPSLPAARGLNELQRFTKLKSLNLSNNHLGDFPLAVCSIPTLAELN
VSCNALRSVPAAVGVMHNLQTFLLDGNFLQSLPAELENMKQLSYLGLSFNEFTDIPEVLE
KLTAVDKLCMSGNCVETLRLQALRKMPHIKHVDLRLNVIRKLIADEVDFLQHVTQLDLRD
NKLGDLDAMIFNNIEVLHCERNQLVTLDICGYFLKALYASSNELVQLDVYPVPNYLSYMD
VSRNRLENVPEWVCESRKLEVLDIGHNQICELPARLFCNSSLRKLLAGHNQLARLPERLE
RTSVEVLDVQHNQLLELPPNLLMKADSLRFLNASANKLESLPPATLSEETNSILQELYLT
NNSLTDKCVPLLTGHPHLKILHMAYNRLQSFPASKMAKLEELEEIDLSGNKLKAIPTTIM
NCRRMHTVIAHSNCIEVFPEVMQLPEIKCVDLSCNELSEVTLPENLPPKLQELDLTGNPR
LVLDHKTLELLNNIRCFKIDQPSTGDASGAPAVWSHGYTEASGVKNKLCVAALSVNNFCD
NREALYGVFDGDRNVEVPYLLQCTMSDILAEELQKTKNEEEYMVNTFIVMQRKLGTAGQK
LGGAAVLCHIKHDPVDPGGSFTLTSANVGKCQTVLCRNGKPLPLSRSYIMSCEEELKRIK
QHKAIITEDGKVNGVTESTRILGYTFLHPSVVPRPHVQSVLLTPQDEFFILGSKGLWDSL
SVEEAVEAVRNVPDALAAAKKLCTLAQSYGCHDSISAVVVQLSVTEDSFCCCELSAGGAV
PPPSPGIFPPSVNMVIKDRPSDGLGVPSSSSGMASEISSELSTSEMSSEVGSTASDEPPP
GALSENSPAYPSEQRCMLHPICLSNSFQRQLSSATFSSAFSDNGLDSDDEEPIEGVFTNG
SRVEVEVDIHCSRAKEKEKQQHLLQVPAEASDEGIVISANEDEPGLPRKADFSAVGTIGR
RRANGSVAPQERSHNVIEVATDAPLRKPGGYFAAPAQPDPDDQFIIPPELEEEVKEIMKH
HQEQQQQQQPPPPPQLQPQLPRHYQLDQLPDYYDTPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60346	1.000	1.000	0.000	1717	1.000	1.000	O60346.pdb.gz	PHLP1_HUMAN PH domain leucine-rich repeat-containing protein phosphatase 1 OS=Homo sapiens OX=9606 GN=PHLPP1 PE=1 SV=3
2	AFDB:P08678	0.446	0.380	1.018E-43	2026	0.155	0.131	P08678.pdb.gz	CYAA_YEAST Adenylate cyclase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CYR1 PE=1 SV=2
3	PDB:7tvfD	0.208	0.626	1.890E-18	515	0.079	0.262	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
4	PDB:4oicB	0.137	0.729	3.577E-16	305	0.046	0.259	4oicB.pdb.gz	Identification and characterization of ABA receptors in Oryza sativa
5	AFDB:Q96RT1	0.185	0.220	6.881E-15	1412	0.094	0.115	Q96RT1.pdb.gz	ERBIN_HUMAN Erbin OS=Homo sapiens OX=9606 GN=ERBIN PE=1 SV=2
6	AFDB:Q96NW7	0.174	0.192	3.891E-14	1537	0.097	0.109	Q96NW7.pdb.gz	LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens OX=9606 GN=LRRC7 PE=1 SV=1
7	AFDB:Q80TH2	0.191	0.229	1.460E-13	1402	0.092	0.113	Q80TH2.pdb.gz	ERBIN_MOUSE Erbin OS=Mus musculus OX=10090 GN=Erbin PE=1 SV=3
8	PDB:1a6qA	0.139	0.629	2.215E-13	363	0.031	0.149	1a6qA.pdb.gz	Crystal structure of the protein serine/threonine phosphatase 2C at 2.0 A resolution.
9	PDB:4jndA	0.138	0.548	2.540E-13	408	0.033	0.137	4jndA.pdb.gz	Structural insight into Caenorhabditis elegans sex-determining protein FEM-2.
10	AFDB:P70587	0.171	0.194	5.233E-13	1490	0.096	0.110	P70587.pdb.gz	LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus OX=10116 GN=Lrrc7 PE=1 SV=2
11	PDB:6gffI	0.236	0.660	2.719E-12	551	0.074	0.230	6gffI.pdb.gz
12	PDB:7kprA	0.124	0.479	4.917E-10	403	0.034	0.146	7kprA.pdb.gz	Structural basis for the specificity of PPM1H phosphatase for Rab GTPases.
13	PDB:5nzzD	0.122	0.482	6.176E-10	379	0.039	0.177	5nzzD.pdb.gz	The TAB1-p38 alpha complex aggravates myocardial injury and can be targeted by small molecules.
14	PDB:7wv3A	0.175	0.365	1.281E-9	668	0.063	0.163	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
15	PDB:3t6qA	0.164	0.374	4.191E-9	601	0.054	0.155	3t6qA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
16	PDB:6hkwA	0.125	0.519	7.243E-9	306	0.038	0.212	6hkwA.pdb.gz
17	AFDB:M0R9T2	0.108	0.142	3.798E-5	1258	0.062	0.085	M0R9T2.pdb.gz	M0R9T2_RAT Erbb2 interacting protein OS=Rattus norvegicus OX=10116 GN=Erbin PE=1 SV=3
18	AFDB:A0A1D8PLJ2	0.048	0.071	2.099E-3	1141	0.051	0.076	A0A1D8PLJ2.pdb.gz	A0A1D8PLJ2_CANAL Bem3p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BEM3 PE=4 SV=1
19	AFDB:P34288	0.054	0.058	2.519E-3	1605	0.057	0.061	P34288.pdb.gz	PAC1_CAEEL GTPase-activating protein pac-1 OS=Caenorhabditis elegans OX=6239 GN=pac-1 PE=1 SV=4
20	AFDB:Q583D6	0.118	0.138	7.875E-3	1471	0.031	0.036	Q583D6.pdb.gz	Q583D6_TRYB2 Protein phosphatase 2C, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.3I12.880 PE=3 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A0Z2	0.0	1243	1193	0.384	0.552	A0A8I6A0Z2_RAT PH domain and leucine rich repeat protein phosphatase 2 OS=Rattus norvegicus OX=10116 GN=Phlpp2 PE=4 SV=1
2	D4A254	0.0	1306	1359	0.400	0.505	D4A254_RAT PH domain and leucine rich repeat protein phosphatase 2 OS=Rattus norvegicus OX=10116 GN=Phlpp2 PE=1 SV=4
3	H3BMS5	0.0	1338	1358	0.401	0.507	H3BMS5_HUMAN PH domain and leucine rich repeat protein phosphatase 2 OS=Homo sapiens OX=9606 GN=PHLPP2 PE=1 SV=1
4	O60346	0.0	3501	1717	1.000	1.000	PHLP1_HUMAN PH domain leucine-rich repeat-containing protein phosphatase 1 OS=Homo sapiens OX=9606 GN=PHLPP1 PE=1 SV=3
5	Q6ZVD8	0.0	1340	1323	0.401	0.521	PHLP2_HUMAN PH domain leucine-rich repeat-containing protein phosphatase 2 OS=Homo sapiens OX=9606 GN=PHLPP2 PE=1 SV=3
6	Q8CHE4	0.0	2750	1687	0.871	0.887	PHLP1_MOUSE PH domain leucine-rich repeat-containing protein phosphatase 1 OS=Mus musculus OX=10090 GN=Phlpp1 PE=1 SV=2
7	Q9WTR8	0.0	2756	1696	0.847	0.858	PHLP1_RAT PH domain leucine-rich repeat protein phosphatase 1 OS=Rattus norvegicus OX=10116 GN=Phlpp1 PE=1 SV=1
8	Q9VJ07	6.81e-51	199	954	0.100	0.180	PHLPP_DROME Protein phosphatase PHLPP-like protein OS=Drosophila melanogaster OX=7227 GN=Phlpp PE=4 SV=1
9	A0A1D8PR83	1.35e-46	187	1690	0.136	0.138	A0A1D8PR83_CANAL Adenylate cyclase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CYR1 PE=3 SV=1
10	P14605	8.69e-41	168	1692	0.122	0.124	CYAA_SCHPO Adenylate cyclase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cyr1 PE=1 SV=1
11	P08678	2.70e-40	166	2026	0.120	0.102	CYAA_YEAST Adenylate cyclase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CYR1 PE=1 SV=2
12	G5EB41	1.16e-26	122	2132	0.066	0.053	G5EB41_EMENI Adenylate cyclase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cyaA PE=3 SV=1
13	Q9UQ13	1.92e-26	119	582	0.080	0.235	SHOC2_HUMAN Leucine-rich repeat protein SHOC-2 OS=Homo sapiens OX=9606 GN=SHOC2 PE=1 SV=2
14	Q9VEK6	1.38e-24	113	641	0.068	0.183	SUR8_DROME Leucine-rich repeat protein soc-2 homolog OS=Drosophila melanogaster OX=7227 GN=Sur-8 PE=2 SV=3
15	Q7KRY7	1.24e-22	108	1851	0.065	0.060	SCRIB_DROME Protein lap4 OS=Drosophila melanogaster OX=7227 GN=scrib PE=1 SV=1
16	P40371	4.01e-21	99.4	347	0.040	0.196	PP2C1_SCHPO Protein phosphatase 2C homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ptc1 PE=2 SV=1
17	Q96RT1	6.21e-21	103	1412	0.062	0.075	ERBIN_HUMAN Erbin OS=Homo sapiens OX=9606 GN=ERBIN PE=1 SV=2
18	A0A8I6AE43	7.08e-21	102	1451	0.064	0.076	A0A8I6AE43_RAT Erbb2 interacting protein OS=Rattus norvegicus OX=10116 GN=Erbin PE=1 SV=1
19	Q9H9A6	7.19e-21	101	602	0.070	0.201	LRC40_HUMAN Leucine-rich repeat-containing protein 40 OS=Homo sapiens OX=9606 GN=LRRC40 PE=1 SV=1
20	A0A8I5ZWX2	8.25e-21	102	1403	0.066	0.081	A0A8I5ZWX2_RAT Erbb2 interacting protein OS=Rattus norvegicus OX=10116 GN=Erbin PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00560 LRR_1	7.3e-05	33.5	Leucine Rich Repeat
2	PF12799 LRR_4	1.2e-26	103.4	Leucine Rich repeats (2 copies)
3	PF13516 LRR_6	3.6e-08	43.9	Leucine Rich repeat
4	PF13855 LRR_8	6.3e-34	126.9	Leucine rich repeat
5	PF00169 PH	0.0074	28.1	PH domain
6	PF00481 PP2C	1.2e-28	112.1	Protein phosphatase 2C

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262719

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000451828	0.999	RAC-alpha serine/threonine-protein kinase
2	9606.ENSP00000263826	0.989	RAC-gamma serine/threonine-protein kinase
3	9606.ENSP00000444810	0.989	Peptidyl-prolyl cis-trans isomerase FKBP5
4	9606.ENSP00000375892	0.983	RAC-beta serine/threonine-protein kinase
5	9606.ENSP00000457991	0.937	PH domain leucine-rich repeat-containing protein phosphatase 2
6	9606.ENSP00000367208	0.924	Protein SGT1 homolog
7	9606.ENSP00000359206	0.918	F-box/WD repeat-containing protein 1A
8	9606.ENSP00000307491	0.915	WD repeat-containing protein 48
9	9606.ENSP00000407818	0.911	Ubiquitin carboxyl-terminal hydrolase 46
10	9606.ENSP00000343526	0.904	Ubiquitin carboxyl-terminal hydrolase 1
11	9606.ENSP00000349486	0.881	Protein scribble homolog
12	9606.ENSP00000361021	0.879	Phosphatase and tensin homolog
13	9606.ENSP00000282344	0.875	Ubiquitin carboxyl-terminal hydrolase 12
14	9606.ENSP00000229922	0.818	Adenylyl cyclase-associated protein 2
15	9606.ENSP00000361883	0.818	Adenylyl cyclase-associated protein 1
16	9606.ENSP00000406084	0.784	WD repeat-containing protein 20
17	9606.ENSP00000379503	0.735	[Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial
18	9606.ENSP00000357836	0.722	Sorting nexin-27
19	9606.ENSP00000225577	0.715	Ribosomal protein S6 kinase beta-1
20	9606.ENSP00000354558	0.702	Serine/threonine-protein kinase mTOR

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016787	0.825	hydrolase activity
GO:0140096	0.803	catalytic activity, acting on a protein
GO:0004722	0.397	protein serine/threonine phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0050794	0.993	regulation of cellular process
GO:0051896	0.916	regulation of protein kinase B signaling
GO:0050896	0.908	response to stimulus
GO:0048523	0.908	negative regulation of cellular process
GO:0048518	0.892	positive regulation of biological process
GO:0009987	0.887	cellular process
GO:0009968	0.815	negative regulation of signal transduction
GO:0043408	0.808	regulation of MAPK cascade
GO:0019222	0.715	regulation of metabolic process
GO:0008152	0.687	metabolic process
GO:0048522	0.677	positive regulation of cellular process
GO:0051898	0.660	negative regulation of protein kinase B signaling
GO:0080135	0.646	regulation of cellular response to stress
GO:0031323	0.639	regulation of cellular metabolic process
GO:0070302	0.622	regulation of stress-activated protein kinase signaling cascade
GO:0060255	0.608	regulation of macromolecule metabolic process
GO:0032872	0.592	regulation of stress-activated MAPK cascade
GO:0071704	0.567	organic substance metabolic process
GO:0044238	0.551	primary metabolic process
GO:0006807	0.524	nitrogen compound metabolic process
GO:0044237	0.499	cellular metabolic process
GO:0080090	0.473	regulation of primary metabolic process
GO:0051171	0.453	regulation of nitrogen compound metabolic process
GO:1901564	0.429	organonitrogen compound metabolic process
GO:0051716	0.420	cellular response to stimulus
GO:0032501	0.418	multicellular organismal process
GO:0010941	0.418	regulation of cell death
GO:0048584	0.415	positive regulation of response to stimulus
GO:0043170	0.394	macromolecule metabolic process
GO:0036211	0.377	protein modification process
GO:0007154	0.355	cell communication
GO:1900744	0.354	regulation of p38MAPK cascade
GO:0007165	0.307	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005654	0.992	nucleoplasm
GO:0016020	0.990	membrane
GO:0071944	0.978	cell periphery
GO:0005886	0.960	plasma membrane
GO:0012505	0.570	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.825	Hydrolases.
EC:3.1.3.16	0.397	protein-serine/threonine phosphatase.

[back to server]