StarFunc result for job id O60356

User Input

>input (82 residues)
MATFPPATSAPQQPPGPEDEDSSLDESDLYSLAHSYLGGGGRKGRTKREAAANTNRPSPG
GHERKLVTKLQNSERKKRGARR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024QZC4	0.427	0.427	1.968E-11	82	1.000	1.000	A0A024QZC4.pdb.gz
2	AFDB:O54842	0.317	0.324	1.661E-7	80	0.720	0.738	O54842.pdb.gz	NUPR1_RAT Nuclear protein 1 OS=Rattus norvegicus OX=10116 GN=Nupr1 PE=2 SV=1
3	AFDB:A0A2R8Q606	0.286	0.311	3.068E-4	75	0.402	0.440	A0A2R8Q606.pdb.gz
4	AFDB:A0A0S2Z4D9	0.227	0.169	2.588	111	0.159	0.117	A0A0S2Z4D9.pdb.gz	A0A0S2Z4D9_HUMAN Glutamate decarboxylase 1 isoform 2 OS=Homo sapiens OX=9606 GN=GAD1 PE=1 SV=1
5	AFDB:H3BRB3	0.265	0.046	2.782	611	0.232	0.031	H3BRB3.pdb.gz	H3BRB3_HUMAN Kinesin-like protein OS=Homo sapiens OX=9606 GN=KIF22 PE=1 SV=2
6	AFDB:O14081	0.271	0.026	2.991	944	0.232	0.020	O14081.pdb.gz	TPSX_SCHPO Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 106 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC2E11.16c PE=1 SV=1
7	AFDB:Q9LID0	0.155	0.040	2.991	746	0.159	0.017	Q9LID0.pdb.gz	LDL2_ARATH Lysine-specific histone demethylase 1 homolog 2 OS=Arabidopsis thaliana OX=3702 GN=LDL2 PE=1 SV=1
8	AFDB:F4JC32	0.286	0.283	3.215	83	0.159	0.157	F4JC32.pdb.gz	F4JC32_ARATH 60S ribosomal protein L29 OS=Arabidopsis thaliana OX=3702 GN=At3g06680 PE=1 SV=1
9	AFDB:Q8RWT4	0.305	0.085	3.994	415	0.146	0.029	Q8RWT4.pdb.gz	Q8RWT4_ARATH Large ribosomal subunit protein uL1c OS=Arabidopsis thaliana OX=3702 GN=At2g42710 PE=1 SV=1
10	AFDB:O74464	0.351	0.136	4.294	249	0.146	0.048	O74464.pdb.gz	RM22_SCHPO Large ribosomal subunit protein uL22m OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mrpl22 PE=3 SV=1
11	PDB:7ohrw	0.232	0.100	4.617	198	0.159	0.066	7ohrw.pdb.gz	Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
12	PDB:4v8mBN	0.154	0.089	7.126	215	0.134	0.051	4v8mBN.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
13	PDB:7pd3q	0.267	0.120	7.661	198	0.244	0.101	7pd3q.pdb.gz	Visualizing formation of the active site in the mitochondrial ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60356	7.97e-55	166	82	1.000	1.000	NUPR1_HUMAN Nuclear protein 1 OS=Homo sapiens OX=9606 GN=NUPR1 PE=1 SV=1
2	O54842	1.15e-36	120	80	0.720	0.738	NUPR1_RAT Nuclear protein 1 OS=Rattus norvegicus OX=10116 GN=Nupr1 PE=2 SV=1
3	Q9WTK0	9.59e-35	115	80	0.707	0.725	NUPR1_MOUSE Nuclear protein 1 OS=Mus musculus OX=10090 GN=Nupr1 PE=1 SV=1
4	E9QCY4	4.66e-17	70.5	75	0.378	0.413	E9QCY4_DANRE Nuclear protein 1 OS=Danio rerio OX=7955 GN=fd46g12 PE=1 SV=1
5	A6NF83	4.45e-12	58.2	97	0.439	0.371	NUPR2_HUMAN Nuclear protein 2 OS=Homo sapiens OX=9606 GN=NUPR2 PE=2 SV=1
6	Q68E01	1.1	29.6	1043	0.195	0.015	INT3_HUMAN Integrator complex subunit 3 OS=Homo sapiens OX=9606 GN=INTS3 PE=1 SV=1
7	Q7Y3F1	1.7	28.9	465	0.146	0.026	Q7Y3F1_9CAUD PlyCA OS=Fischettivirus C1 OX=230871 GN=orf11 PE=1 SV=2
8	Q9NXL6	3.0	28.1	827	0.134	0.013	SIDT1_HUMAN SID1 transmembrane family member 1 OS=Homo sapiens OX=9606 GN=SIDT1 PE=2 SV=2
9	Q9Z2Q3	3.0	28.1	473	0.220	0.038	HYAL2_RAT Hyaluronidase-2 OS=Rattus norvegicus OX=10116 GN=Hyal2 PE=2 SV=1
10	P19021	3.3	28.1	973	0.280	0.024	AMD_HUMAN Peptidyl-glycine alpha-amidating monooxygenase OS=Homo sapiens OX=9606 GN=PAM PE=1 SV=2
11	Q04400	4.1	27.7	1262	0.195	0.013	ADCY5_RAT Adenylate cyclase type 5 OS=Rattus norvegicus OX=10116 GN=Adcy5 PE=1 SV=2
12	P84309	4.4	27.7	1262	0.195	0.013	ADCY5_MOUSE Adenylate cyclase type 5 OS=Mus musculus OX=10090 GN=Adcy5 PE=1 SV=2
13	A0A384P5Q5	5.1	27.7	1261	0.220	0.014	A0A384P5Q5_HUMAN adenylate cyclase OS=Homo sapiens OX=9606 PE=2 SV=1
14	O95622	5.1	27.7	1261	0.220	0.014	ADCY5_HUMAN Adenylate cyclase type 5 OS=Homo sapiens OX=9606 GN=ADCY5 PE=1 SV=3
15	Q9FLC0	6.3	27.3	324	0.146	0.037	PER52_ARATH Peroxidase 52 OS=Arabidopsis thaliana OX=3702 GN=PER52 PE=2 SV=1
16	P95251	6.6	27.3	406	0.232	0.047	MCE3R_MYCTU Transcriptional repressor Mce3R OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=mce3R PE=1 SV=2
17	Q9SFB0	7.4	26.9	526	0.110	0.017	DTX43_ARATH Protein DETOXIFICATION 43 OS=Arabidopsis thaliana OX=3702 GN=DTX43 PE=1 SV=1
18	O35632	7.9	26.9	473	0.220	0.038	HYAL2_MOUSE Hyaluronidase-2 OS=Mus musculus OX=10090 GN=Hyal2 PE=1 SV=2
19	Q9VPL5	9.5	26.9	715	0.232	0.027	Q9VPL5_DROME LD27216p OS=Drosophila melanogaster OX=7227 GN=Tbc1d15-17 PE=1 SV=1
20	D3K5I7	9.6	26.6	245	0.171	0.057	NCAP_RVFV Nucleoprotein OS=Rift valley fever virus OX=11588 GN=N PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10195 Phospho_p8	1.7e-19	81.4	DNA-binding nuclear phosphoprotein p8

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003811192.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003806166.1	0.636	This protein promotes the GTP-dependent binding of aminoacyl- tRNA to the A-site of ribosomes during protein biosynthesis.
2	9597.XP_003806163.1	0.631	Rab GTPase-binding effector protein 2
3	9597.XP_008959996.1	0.631	EF-hand calcium binding domain 13
4	9597.XP_003804499.1	0.570	Interleukin-18 receptor 1
5	9597.XP_003821723.1	0.553	Tumor protein p53 inducible nuclear protein 1
6	9597.XP_008963201.1	0.534	Galactoside-binding soluble lectin 13 isoform X1
7	9597.XP_008957446.1	0.530	SH3 domain-containing RING finger protein 3
8	9597.XP_008962337.1	0.530	UDP-glucuronic acid decarboxylase 1 isoform X1
9	9597.XP_003810114.1	0.518	Acts as a tumor suppressor in many tumor types

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.667	organic cyclic compound binding
GO:1901363	0.638	heterocyclic compound binding
GO:0003676	0.631	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0060255	0.984	regulation of macromolecule metabolic process
GO:0051171	0.981	regulation of nitrogen compound metabolic process
GO:0031324	0.978	negative regulation of cellular metabolic process
GO:0019219	0.970	regulation of nucleobase-containing compound metabolic process
GO:0048518	0.967	positive regulation of biological process
GO:0009889	0.965	regulation of biosynthetic process
GO:0048522	0.964	positive regulation of cellular process
GO:0031326	0.962	regulation of cellular biosynthetic process
GO:0051173	0.957	positive regulation of nitrogen compound metabolic process
GO:0048583	0.955	regulation of response to stimulus
GO:0010604	0.955	positive regulation of macromolecule metabolic process
GO:0031329	0.917	regulation of cellular catabolic process
GO:0060548	0.915	negative regulation of cell death
GO:0043066	0.913	negative regulation of apoptotic process
GO:0080135	0.910	regulation of cellular response to stress
GO:0043467	0.901	regulation of generation of precursor metabolites and energy
GO:1900542	0.901	regulation of purine nucleotide metabolic process
GO:0006109	0.895	regulation of carbohydrate metabolic process
GO:2001242	0.883	regulation of intrinsic apoptotic signaling pathway
GO:0043470	0.875	regulation of carbohydrate catabolic process
GO:0044087	0.872	regulation of cellular component biogenesis
GO:1905897	0.872	regulation of response to endoplasmic reticulum stress
GO:0010506	0.871	regulation of autophagy
GO:0009987	0.867	cellular process
GO:1903578	0.863	regulation of ATP metabolic process
GO:0031330	0.855	negative regulation of cellular catabolic process
GO:0010556	0.854	regulation of macromolecule biosynthetic process
GO:0010468	0.851	regulation of gene expression
GO:0051246	0.848	regulation of protein metabolic process
GO:0010675	0.845	regulation of cellular carbohydrate metabolic process
GO:0006355	0.843	regulation of DNA-templated transcription
GO:0045912	0.831	negative regulation of carbohydrate metabolic process
GO:0006110	0.831	regulation of glycolytic process
GO:1902115	0.816	regulation of organelle assembly
GO:0065009	0.806	regulation of molecular function
GO:0010507	0.805	negative regulation of autophagy
GO:0010677	0.804	negative regulation of cellular carbohydrate metabolic process
GO:0062014	0.797	negative regulation of small molecule metabolic process
GO:0010662	0.787	regulation of striated muscle cell apoptotic process
GO:2001235	0.787	positive regulation of apoptotic signaling pathway
GO:2001244	0.772	positive regulation of intrinsic apoptotic signaling pathway
GO:0044088	0.737	regulation of vacuole organization
GO:0043457	0.737	regulation of cellular respiration
GO:0016242	0.737	negative regulation of macroautophagy
GO:0010639	0.719	negative regulation of organelle organization
GO:0051247	0.715	positive regulation of protein metabolic process
GO:1903050	0.709	regulation of proteolysis involved in protein catabolic process
GO:2000785	0.673	regulation of autophagosome assembly
GO:0042176	0.673	regulation of protein catabolic process
GO:1902116	0.673	negative regulation of organelle assembly
GO:0010667	0.659	negative regulation of cardiac muscle cell apoptotic process
GO:0031325	0.641	positive regulation of cellular metabolic process
GO:1903715	0.639	regulation of aerobic respiration
GO:0061136	0.634	regulation of proteasomal protein catabolic process
GO:1903052	0.631	positive regulation of proteolysis involved in protein catabolic process
GO:0010939	0.535	regulation of necrotic cell death
GO:0008152	0.493	metabolic process
GO:0071704	0.467	organic substance metabolic process
GO:0051172	0.438	negative regulation of nitrogen compound metabolic process
GO:0044092	0.405	negative regulation of molecular function
GO:0051726	0.404	regulation of cell cycle
GO:0009896	0.367	positive regulation of catabolic process
GO:0006807	0.354	nitrogen compound metabolic process
GO:0044238	0.312	primary metabolic process
GO:0043170	0.312	macromolecule metabolic process
GO:0051090	0.307	regulation of DNA-binding transcription factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0045171	0.999	intercellular bridge
GO:0005737	0.930	cytoplasm
GO:0032991	0.824	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]