StarFunc result for job id O60359

User Input

>input (315 residues)
MRMCDRGIQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCRTKSTSDNETSRKNEEVMTH
SGLWRTCCLEGAFRGVCKKIDHFPEDADYEQDTAEYLLRAVRASSVFPILSVTLLFFGGL
CVAASEFHRSRHNVILSAGIFFVSAGLSNIIGIIVYISANAGDPGQRDSKKSYSYGWSFY
FGAFSFIIAEIVGVVAVHIYIEKHQQLRAKSHSEFLKKSTFARLPPYRYRFRRRSSSRST
EPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKITMGTLLNSDRDHAFLQFHNSTPKEFK
ESLHNNPANRRTTPV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60359	1.000	1.000	9.872E-49	315	1.000	1.000	O60359.pdb.gz	CCG3_HUMAN Voltage-dependent calcium channel gamma-3 subunit OS=Homo sapiens OX=9606 GN=CACNG3 PE=2 SV=1
2	AFDB:O88602	0.745	0.728	5.282E-39	323	0.762	0.743	O88602.pdb.gz	CCG2_MOUSE Voltage-dependent calcium channel gamma-2 subunit OS=Mus musculus OX=10090 GN=Cacng2 PE=1 SV=1
3	AFDB:Q6PFS3	0.707	0.688	1.525E-37	324	0.711	0.691	Q6PFS3.pdb.gz	Q6PFS3_DANRE Voltage-dependent calcium channel gamma-2 subunit OS=Danio rerio OX=7955 GN=cacng2 PE=2 SV=1
4	AFDB:Q8VHW9	0.663	0.640	3.134E-31	327	0.559	0.538	Q8VHW9.pdb.gz	CCG4_RAT Voltage-dependent calcium channel gamma-4 subunit OS=Rattus norvegicus OX=10116 GN=Cacng4 PE=1 SV=1
5	PDB:5weoA	0.563	0.185	4.616E-21	988	0.508	0.162	5weoA.pdb.gz	Channel opening and gating mechanism in AMPA-subtype glutamate receptors.
6	PDB:7ocaI	0.557	0.936	2.619E-20	185	0.387	0.659	7ocaI.pdb.gz	Gating and modulation of a hetero-octameric AMPA glutamate receptor.
7	PDB:5kbtA	0.497	0.176	8.426E-19	973	0.498	0.161	5kbtA.pdb.gz	Elucidation of AMPA receptor-stargazin complexes by cryo-electron microscopy.
8	AFDB:Q8VHW8	0.518	0.590	6.573E-17	275	0.241	0.276	Q8VHW8.pdb.gz	CCG5_RAT Voltage-dependent calcium channel gamma-5 subunit OS=Rattus norvegicus OX=10116 GN=Cacng5 PE=1 SV=1
9	AFDB:P62955	0.590	0.669	2.115E-15	275	0.238	0.273	P62955.pdb.gz	CCG7_HUMAN Voltage-dependent calcium channel gamma-7 subunit OS=Homo sapiens OX=9606 GN=CACNG7 PE=1 SV=1
10	PDB:7rz4A	0.511	0.170	8.305E-14	993	0.203	0.064	7rz4A.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
11	PDB:5kk2E	0.431	0.713	1.327E-10	173	0.429	0.780	5kk2E.pdb.gz
12	AFDB:Q2KHT4	0.516	0.468	1.871E-10	349	0.178	0.160	Q2KHT4.pdb.gz	GSG1_HUMAN Germ cell-specific gene 1 protein OS=Homo sapiens OX=9606 GN=GSG1 PE=1 SV=2
13	AFDB:Q07651	0.425	0.431	1.880E-8	309	0.130	0.133	Q07651.pdb.gz	FMP45_YEAST SUR7 family protein FMP45 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FMP45 PE=1 SV=1
14	AFDB:Q9N419	0.419	0.432	3.805E-8	303	0.133	0.139	Q9N419.pdb.gz	Q9N419_CAEEL Clc-like protein OS=Caenorhabditis elegans OX=6239 GN=nsy-4 PE=1 SV=3
15	AFDB:A1Z6H0	0.420	0.485	9.063E-8	264	0.152	0.182	A1Z6H0.pdb.gz	A1Z6H0_DROME Kune-kune OS=Drosophila melanogaster OX=7227 GN=kune PE=1 SV=1
16	PDB:7rzaA	0.481	0.164	1.531E-7	981	0.140	0.045	7rzaA.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
17	PDB:6ov2A	0.412	0.681	2.570E-6	182	0.092	0.159	6ov2A.pdb.gz
18	PDB:6jp5E	0.402	0.717	4.421E-6	169	0.117	0.219	6jp5E.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
19	PDB:5b2gC	0.392	0.359	6.122E-6	350	0.108	0.097	5b2gC.pdb.gz
20	PDB:6wxuB	0.355	0.397	1.912E-5	273	0.079	0.092	6wxuB.pdb.gz	Structures of mouse DUOX1-DUOXA1 provide mechanistic insights into enzyme activation and regulation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60359	0.0	655	315	1.000	1.000	CCG3_HUMAN Voltage-dependent calcium channel gamma-3 subunit OS=Homo sapiens OX=9606 GN=CACNG3 PE=2 SV=1
2	Q8VHX0	0.0	649	315	0.987	0.987	CCG3_RAT Voltage-dependent calcium channel gamma-3 subunit OS=Rattus norvegicus OX=10116 GN=Cacng3 PE=1 SV=1
3	Q9JJV5	0.0	649	315	0.987	0.987	CCG3_MOUSE Voltage-dependent calcium channel gamma-3 subunit OS=Mus musculus OX=10090 GN=Cacng3 PE=1 SV=2
4	Q9Y698	1.18e-166	468	323	0.762	0.743	CCG2_HUMAN Voltage-dependent calcium channel gamma-2 subunit OS=Homo sapiens OX=9606 GN=CACNG2 PE=1 SV=1
5	O88602	6.36e-166	466	323	0.759	0.740	CCG2_MOUSE Voltage-dependent calcium channel gamma-2 subunit OS=Mus musculus OX=10090 GN=Cacng2 PE=1 SV=1
6	Q71RJ2	6.36e-166	466	323	0.759	0.740	CCG2_RAT Voltage-dependent calcium channel gamma-2 subunit OS=Rattus norvegicus OX=10116 GN=Cacng2 PE=1 SV=1
7	Q6PFS3	1.14e-151	430	324	0.708	0.688	Q6PFS3_DANRE Voltage-dependent calcium channel gamma-2 subunit OS=Danio rerio OX=7955 GN=cacng2 PE=2 SV=1
8	Q9JJV4	4.08e-108	319	327	0.587	0.566	CCG4_MOUSE Voltage-dependent calcium channel gamma-4 subunit OS=Mus musculus OX=10090 GN=Cacng4 PE=1 SV=1
9	Q8VHW9	3.69e-107	317	327	0.581	0.560	CCG4_RAT Voltage-dependent calcium channel gamma-4 subunit OS=Rattus norvegicus OX=10116 GN=Cacng4 PE=1 SV=1
10	Q9UBN1	3.86e-107	317	327	0.581	0.560	CCG4_HUMAN Voltage-dependent calcium channel gamma-4 subunit OS=Homo sapiens OX=9606 GN=CACNG4 PE=1 SV=1
11	Q8VHW5	1.05e-101	306	421	0.537	0.401	CCG8_RAT Voltage-dependent calcium channel gamma-8 subunit OS=Rattus norvegicus OX=10116 GN=Cacng8 PE=1 SV=1
12	Q8VHW2	3.50e-101	305	423	0.533	0.397	CCG8_MOUSE Voltage-dependent calcium channel gamma-8 subunit OS=Mus musculus OX=10090 GN=Cacng8 PE=1 SV=1
13	Q8WXS5	1.25e-98	298	425	0.521	0.386	CCG8_HUMAN Voltage-dependent calcium channel gamma-8 subunit OS=Homo sapiens OX=9606 GN=CACNG8 PE=2 SV=3
14	Q8VHW8	1.08e-31	121	275	0.210	0.240	CCG5_RAT Voltage-dependent calcium channel gamma-5 subunit OS=Rattus norvegicus OX=10116 GN=Cacng5 PE=1 SV=1
15	Q9UF02	2.37e-31	120	275	0.213	0.244	CCG5_HUMAN Voltage-dependent calcium channel gamma-5 subunit OS=Homo sapiens OX=9606 GN=CACNG5 PE=2 SV=2
16	P62955	2.87e-27	109	275	0.200	0.229	CCG7_HUMAN Voltage-dependent calcium channel gamma-7 subunit OS=Homo sapiens OX=9606 GN=CACNG7 PE=1 SV=1
17	P62956	2.87e-27	109	275	0.200	0.229	CCG7_MOUSE Voltage-dependent calcium channel gamma-7 subunit OS=Mus musculus OX=10090 GN=Cacng7 PE=1 SV=1
18	P62957	2.87e-27	109	275	0.200	0.229	CCG7_RAT Voltage-dependent calcium channel gamma-7 subunit OS=Rattus norvegicus OX=10116 GN=Cacng7 PE=1 SV=1
19	Q9VRE6	3.65e-11	65.9	447	0.197	0.139	Q9VRE6_DROME GH12419p1 OS=Drosophila melanogaster OX=7227 GN=stg1 PE=2 SV=3
20	G5EDT2	3.75e-07	53.5	366	0.137	0.117	G5EDT2_CAEEL STarGazin (Mammalian calcium channel) homolog OS=Caenorhabditis elegans OX=6239 GN=stg-1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13903 Claudin_2	9.5e-17	72.9	PMP-22/EMP/MP20/Claudin tight junction
2	PF00822 PMP22_Claudin	5.2e-47	171.3	PMP-22/EMP/MP20/Claudin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008583001.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008589524.1	0.986	Glutamate receptor 2
2	482537.XP_008589050.1	0.973	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 33 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments
3	482537.XP_008572761.1	0.969	Glutamate receptor 3 isoform X1
4	482537.XP_008582028.1	0.947	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 mRNAs, 7 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
5	482537.XP_008570828.1	0.941	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 24 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
6	482537.XP_008586491.1	0.938	Glutamate receptor ionotropic, NMDA 2C
7	482537.XP_008566360.1	0.937	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 mRNAs, 6 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
8	482537.XP_008573357.1	0.937	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 17 Proteins, and 96% coverage of the annotated genomic feature by RNAseq alignments
9	482537.XP_008574701.1	0.937	Glutamate receptor ionotropic, NMDA 1 isoform X1
10	482537.XP_008582233.1	0.937	Voltage-dependent calcium channel gamma-5 subunit
11	482537.XP_008582034.1	0.936	Voltage-dependent calcium channel gamma-8 subunit
12	482537.XP_008585386.1	0.936	Protein cornichon homolog 2
13	482537.XP_008568904.1	0.935	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 80 Proteins, and 96% coverage of the annotated genomic feature by RNAseq alignments
14	482537.XP_008586244.1	0.935	Glutamate receptor ionotropic, NMDA 3B
15	482537.XP_008567551.1	0.934	Glutamate receptor ionotropic, NMDA 2D
16	482537.XP_008582077.1	0.934	Voltage-dependent calcium channel gamma-2 subunit
17	482537.XP_008585874.1	0.933	Protein cornichon homolog 3
18	482537.XP_008565478.1	0.927	Glutamate receptor ionotropic, kainate 5
19	482537.XP_008581245.1	0.927	Glutamate receptor ionotropic, kainate 4
20	482537.XP_008591694.1	0.925	Noelin-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0015075	0.888	monoatomic ion transmembrane transporter activity
GO:0015318	0.867	inorganic molecular entity transmembrane transporter activity
GO:0005216	0.836	monoatomic ion channel activity
GO:0022836	0.826	gated channel activity
GO:0022839	0.817	monoatomic ion gated channel activity
GO:0022890	0.813	inorganic cation transmembrane transporter activity
GO:1901702	0.805	salt transmembrane transporter activity
GO:0005261	0.795	monoatomic cation channel activity
GO:0046873	0.785	metal ion transmembrane transporter activity
GO:0005244	0.702	voltage-gated monoatomic ion channel activity
GO:0005102	0.668	signaling receptor binding
GO:0015085	0.662	calcium ion transmembrane transporter activity
GO:0035254	0.653	glutamate receptor binding
GO:0005262	0.611	calcium channel activity
GO:0022843	0.595	voltage-gated monoatomic cation channel activity
GO:0005245	0.588	voltage-gated calcium channel activity
GO:0035255	0.587	ionotropic glutamate receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050794	0.993	regulation of cellular process
GO:0032879	0.965	regulation of localization
GO:0051049	0.947	regulation of transport
GO:0050896	0.936	response to stimulus
GO:0010646	0.928	regulation of cell communication
GO:0034762	0.900	regulation of transmembrane transport
GO:0032409	0.896	regulation of transporter activity
GO:0023051	0.859	regulation of signaling
GO:0048583	0.833	regulation of response to stimulus
GO:0022898	0.823	regulation of transmembrane transporter activity
GO:0010469	0.815	regulation of signaling receptor activity
GO:0099601	0.782	regulation of neurotransmitter receptor activity
GO:0032412	0.780	regulation of monoatomic ion transmembrane transporter activity
GO:0051179	0.777	localization
GO:0007154	0.770	cell communication
GO:0051234	0.753	establishment of localization
GO:0006810	0.743	transport
GO:0065008	0.732	regulation of biological quality
GO:0023052	0.688	signaling
GO:0051716	0.642	cellular response to stimulus
GO:0007165	0.602	signal transduction
GO:0032501	0.503	multicellular organismal process
GO:0071702	0.491	organic substance transport
GO:0048518	0.460	positive regulation of biological process
GO:0006605	0.451	protein targeting
GO:1902414	0.434	protein localization to cell junction
GO:0099072	0.425	regulation of postsynaptic membrane neurotransmitter receptor levels
GO:0031503	0.420	protein-containing complex localization
GO:0051668	0.402	localization within membrane
GO:0097120	0.398	receptor localization to synapse
GO:0072657	0.385	protein localization to membrane
GO:0062237	0.335	protein localization to postsynapse
GO:0043269	0.333	regulation of monoatomic ion transport
GO:1990778	0.332	protein localization to cell periphery
GO:0048522	0.313	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.999	organelle
GO:0005886	0.999	plasma membrane
GO:0032991	0.993	protein-containing complex
GO:0030054	0.989	cell junction
GO:0005737	0.989	cytoplasm
GO:0043231	0.971	intracellular membrane-bounded organelle
GO:0034702	0.971	ion channel complex
GO:0098797	0.969	plasma membrane protein complex
GO:0045202	0.865	synapse
GO:0031090	0.833	organelle membrane
GO:0031982	0.794	vesicle
GO:0005829	0.765	cytosol
GO:0098984	0.744	neuron to neuron synapse
GO:0032281	0.740	AMPA glutamate receptor complex
GO:0099572	0.739	postsynaptic specialization
GO:0045211	0.737	postsynaptic membrane
GO:0014069	0.728	postsynaptic density
GO:0099634	0.725	postsynaptic specialization membrane
GO:0098839	0.718	postsynaptic density membrane
GO:0098978	0.716	glutamatergic synapse
GO:0036477	0.604	somatodendritic compartment
GO:0120025	0.428	plasma membrane bounded cell projection
GO:0012506	0.427	vesicle membrane
GO:0030139	0.423	endocytic vesicle
GO:0030659	0.423	cytoplasmic vesicle membrane
GO:0012505	0.417	endomembrane system
GO:0098588	0.415	bounding membrane of organelle
GO:0030666	0.404	endocytic vesicle membrane
GO:0043005	0.384	neuron projection
GO:0005634	0.331	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	0.662	Ca(2+)(in) = Ca(2+)(out)

[back to server]