StarFunc result for job id O60381

User Input

>input (514 residues)
MVWEVKTNQMPNAVQKLLLVMDKRASGMNDSLELLQCNENLPSSPGYNSCDEHMELDDLP
ELQAVQSDPTQSGMYQLSSDVSHQEYPRSSWNQNTSDIPETTYRENEVDWLTELANIATS
PQSPLMQCSFYNRSSPVHIIATSKSLHSYARPPPVSSSSKSEPAFPHHHWKEETPVRHER
ANSESESGIFCMSSLSDDDDLGWCNSWPSTVWHCFLKGTRLCFHKGSNKEWQDVEDFARA
EGCDNEEDLQMGIHKGYGSDGLKLLSHEESVSFGESVLKLTFDPGTVEDGLLTVECKLDH
PFYVKNKGWSSFYPSLTVVQHGIPCCEVHIGDVCLPPGHPDAINFDDSGVFDTFKSYDFT
PMDSSAVYVLSSMARQRRASLSCGGPGGQDFARSGFSKNCGSPGSSQLSSNSLYAKAVKN
HSSGTVSATSPNKCKRPMNAFMLFAKKYRVEYTQMYPGKDNRAISVILGDRWKKMKNEER
RMYTLEAKALAEEQKRLNPDCWKRKRTNSGSQQH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8R316	0.398	0.397	5.721E-80	516	0.951	0.948	Q8R316.pdb.gz	HBP1_MOUSE HMG box-containing protein 1 OS=Mus musculus OX=10090 GN=Hbp1 PE=1 SV=1
2	AFDB:O14360	0.076	0.075	8.410E-3	516	0.128	0.128	O14360.pdb.gz	NAF1_SCHPO H/ACA ribonucleoprotein complex non-core subunit NAF1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=naf1 PE=1 SV=1
3	PDB:1j5nA	0.129	0.615	1.124E-2	93	0.039	0.215	1j5nA.pdb.gz	The S. cerevisiae architectural HMGB protein NHP6A complexed with DNA: DNA and protein conformational changes upon binding
4	AFDB:A0A5K7RLP0	0.128	0.114	1.438E-2	589	0.161	0.141	A0A5K7RLP0.pdb.gz	MEIOS_MOUSE Meiosis initiator protein OS=Mus musculus OX=10090 GN=Meiosin PE=1 SV=1
5	AFDB:A0A0C4DGW3	0.069	0.073	3.730E-2	475	0.125	0.135	A0A0C4DGW3.pdb.gz	A0A0C4DGW3_HUMAN Mucin 1, cell surface associated OS=Homo sapiens OX=9606 GN=MUC1 PE=1 SV=1
6	AFDB:Q8CGW4	0.138	0.092	3.730E-2	782	0.156	0.102	Q8CGW4.pdb.gz	SOX30_MOUSE Transcription factor SOX-30 OS=Mus musculus OX=10090 GN=Sox30 PE=1 SV=1
7	AFDB:P39969	0.073	0.047	4.202E-2	1040	0.121	0.060	P39969.pdb.gz	BOI2_YEAST Protein BOI2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BOI2 PE=1 SV=1
8	AFDB:Q09868	0.068	0.062	4.202E-2	576	0.121	0.108	Q09868.pdb.gz	CIP2_SCHPO RNA-binding post-transcriptional regulator cip2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cip2 PE=1 SV=1
9	AFDB:Q9VJ12	0.071	0.056	8.094E-2	739	0.130	0.091	Q9VJ12.pdb.gz	Q9VJ12_DROME Acinus, isoform A OS=Drosophila melanogaster OX=7227 GN=Acn PE=1 SV=1
10	AFDB:Q8VY15	0.078	0.054	8.591E-2	899	0.125	0.071	Q8VY15.pdb.gz	RBM25_ARATH RNA-binding motif protein 25 OS=Arabidopsis thaliana OX=3702 GN=RBM25 PE=1 SV=1
11	AFDB:Q9LT25	0.071	0.047	1.384E-1	835	0.144	0.089	Q9LT25.pdb.gz	PR40C_ARATH Pre-mRNA-processing protein 40C OS=Arabidopsis thaliana OX=3702 GN=PRP40C PE=1 SV=1
12	PDB:3ms6A	0.068	0.260	2.806E-1	91	0.010	0.055	3ms6A.pdb.gz
13	PDB:6umzA	0.093	0.281	3.562E-1	127	0.019	0.079	6umzA.pdb.gz	Structural and spectroscopic characterization of photoactive yellow protein and photoswitchable fluorescent protein constructs containing heavy atoms.
14	PDB:6nzdI	0.086	0.109	5.737E-1	388	0.021	0.028	6nzdI.pdb.gz	Structural mechanism of a Rag GTPase activation checkpoint by the lysosomal folliculin complex.
15	PDB:6cesN	0.077	0.116	6.089E-1	321	0.027	0.044	6cesN.pdb.gz	Architecture of the human GATOR1 and GATOR1-Rag GTPases complexes.
16	PDB:7mgeC	0.077	0.104	6.463E-1	365	0.025	0.036	7mgeC.pdb.gz	Structural basis for the ARF GAP activity and specificity of the C9orf72 complex.
17	PDB:3pvuA	0.052	0.045	6.860E-1	609	0.014	0.011	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
18	PDB:4mk0A	0.051	0.042	7.728E-1	631	0.012	0.010	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
19	PDB:1y4oA	0.074	0.249	8.203E-1	104	0.023	0.115	1y4oA.pdb.gz
20	PDB:3l9kA	0.065	0.228	8.203E-1	95	0.018	0.095	3l9kA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H7C4S2	0.0	950	454	0.883	1.000	H7C4S2_HUMAN HMG-box transcription factor 1 (Fragment) OS=Homo sapiens OX=9606 GN=HBP1 PE=1 SV=1
2	O60381	0.0	1077	514	1.000	1.000	HBP1_HUMAN HMG box-containing protein 1 OS=Homo sapiens OX=9606 GN=HBP1 PE=1 SV=2
3	Q62661	0.0	972	513	0.932	0.934	HBP1_RAT HMG box-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Hbp1 PE=1 SV=2
4	Q8R316	0.0	970	516	0.951	0.948	HBP1_MOUSE HMG box-containing protein 1 OS=Mus musculus OX=10090 GN=Hbp1 PE=1 SV=1
5	C9JQU7	5.57e-84	257	124	0.241	1.000	C9JQU7_HUMAN HMG-box transcription factor 1 (Fragment) OS=Homo sapiens OX=9606 GN=HBP1 PE=1 SV=1
6	C9J5U3	3.73e-74	231	111	0.216	1.000	C9J5U3_HUMAN HMG-box transcription factor 1 (Fragment) OS=Homo sapiens OX=9606 GN=HBP1 PE=1 SV=1
7	C9J8V6	1.66e-71	224	108	0.210	1.000	C9J8V6_HUMAN HMG-box transcription factor 1 (Fragment) OS=Homo sapiens OX=9606 GN=HBP1 PE=1 SV=1
8	Q23045	5.13e-11	67.0	470	0.068	0.074	EGL13_CAEEL Transcription factor egl-13 OS=Caenorhabditis elegans OX=6239 GN=egl-13 PE=1 SV=2
9	Q9U1H0	1.40e-10	66.6	1832	0.062	0.017	CIC_DROME Putative transcription factor capicua OS=Drosophila melanogaster OX=7227 GN=cic PE=1 SV=2
10	A0A0A0MQR4	1.28e-09	63.5	1606	0.078	0.025	A0A0A0MQR4_HUMAN Capicua transcriptional repressor OS=Homo sapiens OX=9606 GN=CIC PE=1 SV=1
11	Q96RK0	1.32e-09	63.5	1608	0.078	0.025	CIC_HUMAN Protein capicua homolog OS=Homo sapiens OX=9606 GN=CIC PE=1 SV=2
12	Q924A2	1.57e-09	63.2	2510	0.078	0.016	CIC_MOUSE Protein capicua homolog OS=Mus musculus OX=10090 GN=Cic PE=1 SV=2
13	Q04891	5.02e-09	61.2	613	0.060	0.051	SOX13_MOUSE Transcription factor SOX-13 OS=Mus musculus OX=10090 GN=Sox13 PE=1 SV=4
14	Q9UN79	6.35e-09	60.8	622	0.060	0.050	SOX13_HUMAN Transcription factor SOX-13 OS=Homo sapiens OX=9606 GN=SOX13 PE=1 SV=3
15	O57396	6.79e-09	60.8	585	0.060	0.053	O57396_ONCMY RtSox23 OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
16	F1Q6M9	1.04e-08	60.8	2623	0.082	0.016	F1Q6M9_DANRE Capicua transcriptional repressor b OS=Danio rerio OX=7955 GN=cicb PE=4 SV=2
17	P40645	1.33e-08	60.1	827	0.064	0.040	SOX6_MOUSE Transcription factor SOX-6 OS=Mus musculus OX=10090 GN=Sox6 PE=1 SV=2
18	P40647	1.37e-08	60.1	757	0.086	0.058	SOX5_XENLA Transcription factor Sox-5 OS=Xenopus laevis OX=8355 GN=sox5 PE=2 SV=2
19	A0A0G2JTZ2	1.40e-08	60.1	827	0.064	0.040	SOX6_RAT Transcription factor SOX-6 OS=Rattus norvegicus OX=10116 GN=Sox6 PE=1 SV=2
20	P35712	1.47e-08	59.7	828	0.064	0.040	SOX6_HUMAN Transcription factor SOX-6 OS=Homo sapiens OX=9606 GN=SOX6 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08517 AXH	6.9e-33	124.9	Ataxin-1 and HBP1 module (AXH)
2	PF00505 HMG_box	1.9e-11	55.5	HMG (high mobility group) box
3	PF09011 HMG_box_2	7.9e-06	37.7	HMG-box domain
4	PF04769 MATalpha_HMGbox	17	16.2	Mating-type protein MAT alpha 1 HMG-box

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003811248.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003819008.1	0.939	SIN3 transcription regulator family member A
2	9597.XP_008964328.1	0.764	SIN3 transcription regulator family member B
3	9597.XP_008949174.1	0.742	Transcription factor 7 like 2
4	9597.XP_003824094.1	0.686	MYC associated factor X
5	9597.XP_003820503.1	0.672	Transcription factor that binds DNA in a non-specific manner, yet also specifically recognizes the core sequence 5'-CAC[GA]TG-3'. Activates the transcription of growth-related genes. Binds to the VEGFA promoter, promoting VEGFA production and subsequent sprouting angiogenesis. Regulator of somatic reprogramming, controls self-renewal of embryonic stem cells. Functions with TAF6L to activate target gene expression through RNA polymerase II pause release (By similarity).
6	9597.XP_003818965.1	0.655	Mitogen-activated protein kinase 14
7	9597.XP_008961655.1	0.655	Mitogen-activated protein kinase 11
8	9597.XP_008949747.1	0.643	Catenin beta 1
9	9597.XP_003824710.1	0.588	Chromosome 1 open reading frame, human C1orf105
10	9597.XP_003825161.1	0.583	N(alpha)-acetyltransferase 50, NatE catalytic subunit
11	9597.XP_008961815.1	0.571	B-cell receptor associated protein 29
12	9597.XP_008954232.1	0.563	Translation initiation factor IF-2, mitochondrial-like
13	9597.XP_008954609.1	0.563	Mitochondrial translational initiation factor 2
14	9597.XP_003832655.1	0.518	Oligomeric Apaf-1 mediates the cytochrome c-dependent autocatalytic activation of pro-caspase-9 (Apaf-3), leading to the activation of caspase-3 and apoptosis. This activation requires ATP.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.957	heterocyclic compound binding
GO:0097159	0.957	organic cyclic compound binding
GO:0003676	0.954	nucleic acid binding
GO:0003677	0.943	DNA binding
GO:0140110	0.909	transcription regulator activity
GO:0043565	0.789	sequence-specific DNA binding
GO:0003700	0.614	DNA-binding transcription factor activity
GO:0003690	0.432	double-stranded DNA binding
GO:1990837	0.375	sequence-specific double-stranded DNA binding
GO:0001067	0.335	transcription regulatory region nucleic acid binding
GO:0000976	0.324	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031323	0.995	regulation of cellular metabolic process
GO:0048519	0.993	negative regulation of biological process
GO:0009889	0.991	regulation of biosynthetic process
GO:0048523	0.982	negative regulation of cellular process
GO:0048518	0.972	positive regulation of biological process
GO:0032879	0.959	regulation of localization
GO:0009892	0.948	negative regulation of metabolic process
GO:0006355	0.940	regulation of DNA-templated transcription
GO:0031324	0.935	negative regulation of cellular metabolic process
GO:0009890	0.894	negative regulation of biosynthetic process
GO:0010605	0.880	negative regulation of macromolecule metabolic process
GO:0051172	0.840	negative regulation of nitrogen compound metabolic process
GO:0031327	0.826	negative regulation of cellular biosynthetic process
GO:0051049	0.818	regulation of transport
GO:0045934	0.796	negative regulation of nucleobase-containing compound metabolic process
GO:0051253	0.718	negative regulation of RNA metabolic process
GO:0010959	0.701	regulation of metal ion transport
GO:0006357	0.694	regulation of transcription by RNA polymerase II
GO:0045892	0.687	negative regulation of DNA-templated transcription
GO:0043266	0.594	regulation of potassium ion transport
GO:0000122	0.556	negative regulation of transcription by RNA polymerase II
GO:0048522	0.539	positive regulation of cellular process
GO:0045595	0.438	regulation of cell differentiation
GO:0009893	0.437	positive regulation of metabolic process
GO:0009987	0.425	cellular process
GO:2000377	0.374	regulation of reactive oxygen species metabolic process
GO:0010604	0.326	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016607	1.000	nuclear speck
GO:0032991	0.347	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]