StarFunc result for job id O60383

User Input

>input (454 residues)
MARPNKFLLWFCCFAWLCFPISLGSQASGGEAQIAASAELESGAMPWSLLQHIDERDRAG
LLPALFKVLSVGRGGSPRLQPDSRALHYMKKLYKTYATKEGIPKSNRSHLYNTVRLFTPC
TRHKQAPGDQVTGILPSVELLFNLDRITTVEHLLKSVLLYNINNSVSFSSAVKCVCNLMI
KEPKSSSRTLGRAPYSFTFNSQFEFGKKHKWIQIDVTSLLQPLVASNKRSIHMSINFTCM
KDQLEHPSAQNGLFNMTLVSPSLILYLNDTSAQAYHSWYSLHYKRRPSQGPDQERSLSAY
PVGEEAAEDGRSSHHRHRRGQETVSSELKKPLGPASFNLSEYFRQFLLPQNECELHDFRL
SFSQLKWDNWIVAPHRYNPRYCKGDCPRAVGHRYGSPVHTMVQNIIYEKLDSSVPRPSCV
PAKYSPLSVLTIEPDGSIAYKEYEDMIATKCTCR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60383	1.000	1.000	1.297E-80	454	1.000	1.000	O60383.pdb.gz	GDF9_HUMAN Growth/differentiation factor 9 OS=Homo sapiens OX=9606 GN=GDF9 PE=1 SV=1
2	AFDB:Q6GUA6	0.736	0.752	4.422E-59	444	0.773	0.791	Q6GUA6.pdb.gz	Q6GUA6_PIG Growth/differentiation factor 9 OS=Sus scrofa OX=9823 GN=GDF9 PE=2 SV=1
3	AFDB:Q07105	0.707	0.727	6.963E-57	441	0.709	0.730	Q07105.pdb.gz	GDF9_MOUSE Growth/differentiation factor 9 OS=Mus musculus OX=10090 GN=Gdf9 PE=2 SV=2
4	AFDB:Q32PR5	0.584	0.630	9.455E-39	418	0.392	0.426	Q32PR5.pdb.gz
5	AFDB:Q0VG66	0.531	0.606	2.329E-25	394	0.253	0.292	Q0VG66.pdb.gz
6	AFDB:Q9Z0L4	0.532	0.610	1.650E-23	392	0.242	0.281	Q9Z0L4.pdb.gz	BMP15_MOUSE Bone morphogenetic protein 15 OS=Mus musculus OX=10090 GN=Bmp15 PE=2 SV=1
7	AFDB:E9PTU9	0.524	0.602	1.835E-23	391	0.231	0.269	E9PTU9.pdb.gz	E9PTU9_RAT Bone morphogenetic protein 15 OS=Rattus norvegicus OX=10116 GN=Bmp15 PE=3 SV=1
8	AFDB:Q8WMY6	0.515	0.585	4.080E-23	394	0.262	0.302	Q8WMY6.pdb.gz	Q8WMY6_PIG Bone morphogenetic protein 15 OS=Sus scrofa OX=9823 GN=BMP15 PE=3 SV=2
9	AFDB:O95972	0.532	0.608	2.016E-22	392	0.264	0.306	O95972.pdb.gz	BMP15_HUMAN Bone morphogenetic protein 15 OS=Homo sapiens OX=9606 GN=BMP15 PE=1 SV=2
10	AFDB:P12645	0.436	0.421	4.986E-22	472	0.231	0.222	P12645.pdb.gz	BMP3_HUMAN Bone morphogenetic protein 3 OS=Homo sapiens OX=9606 GN=BMP3 PE=1 SV=2
11	PDB:5ntuA	0.216	0.306	1.870E-10	308	0.134	0.198	5ntuA.pdb.gz
12	PDB:5hlyA	0.236	0.337	3.942E-10	299	0.123	0.187	5hlyA.pdb.gz
13	PDB:5vqfB	0.231	0.310	6.036E-10	320	0.126	0.178	5vqfB.pdb.gz
14	PDB:3rjrC	0.242	0.305	1.342E-9	343	0.139	0.184	3rjrC.pdb.gz
15	PDB:5nxsA	0.202	0.299	3.691E-9	290	0.123	0.193	5nxsA.pdb.gz
16	PDB:5ffoG	0.239	0.336	1.923E-8	297	0.115	0.175	5ffoG.pdb.gz	Force interacts with macromolecular structure in activation of TGF-beta.
17	PDB:6umxA	0.240	0.359	6.208E-8	279	0.106	0.172	6umxA.pdb.gz
18	PDB:7y1rB	0.188	0.263	3.412E-7	308	0.134	0.198	7y1rB.pdb.gz
19	PDB:5nxsB	0.198	0.339	7.397E-5	251	0.115	0.207	5nxsB.pdb.gz
20	PDB:7l2zF	0.100	0.074	5.829E-3	664	0.040	0.027	7l2zF.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60383	0.0	948	454	1.000	1.000	GDF9_HUMAN Growth/differentiation factor 9 OS=Homo sapiens OX=9606 GN=GDF9 PE=1 SV=1
2	Q07105	0.0	650	441	0.718	0.739	GDF9_MOUSE Growth/differentiation factor 9 OS=Mus musculus OX=10090 GN=Gdf9 PE=2 SV=2
3	Q6GUA6	0.0	682	444	0.742	0.759	Q6GUA6_PIG Growth/differentiation factor 9 OS=Sus scrofa OX=9823 GN=GDF9 PE=2 SV=1
4	Q9QYW4	0.0	669	440	0.733	0.757	Q9QYW4_RAT Growth/differentiation factor 9 OS=Rattus norvegicus OX=10116 GN=Gdf9 PE=3 SV=1
5	Q9Z0X3	0.0	668	440	0.731	0.755	Q9Z0X3_RAT Growth/differentiation factor 9 OS=Rattus norvegicus OX=10116 GN=Gdf9 PE=2 SV=1
6	Q6KCM2	3.43e-135	390	244	0.421	0.783	Q6KCM2_PIG Growth differential factor 9 (Fragment) OS=Sus scrofa OX=9823 GN=GDF9 PE=3 SV=1
7	Q5MD90	4.72e-93	289	418	0.412	0.447	Q5MD90_DANRE Growth and differentiation factor 9 OS=Danio rerio OX=7955 GN=zgc:123030 PE=2 SV=1
8	O95972	6.72e-44	160	392	0.286	0.332	BMP15_HUMAN Bone morphogenetic protein 15 OS=Homo sapiens OX=9606 GN=BMP15 PE=1 SV=2
9	Q8WMY6	3.19e-43	158	394	0.278	0.320	Q8WMY6_PIG Bone morphogenetic protein 15 OS=Sus scrofa OX=9823 GN=BMP15 PE=3 SV=2
10	Q9Z0L4	3.71e-40	150	392	0.256	0.296	BMP15_MOUSE Bone morphogenetic protein 15 OS=Mus musculus OX=10090 GN=Bmp15 PE=2 SV=1
11	E9PTU9	2.07e-36	140	391	0.256	0.297	E9PTU9_RAT Bone morphogenetic protein 15 OS=Rattus norvegicus OX=10116 GN=Bmp15 PE=3 SV=1
12	Q9WUW1	9.34e-36	138	391	0.253	0.294	Q9WUW1_RAT Growth differentiation factor-9B OS=Rattus norvegicus OX=10116 GN=Bmp15 PE=2 SV=1
13	Q58FS4	1.74e-32	129	384	0.240	0.284	Q58FS4_DANRE Bone morphogenetic protein 15 precursor OS=Danio rerio OX=7955 GN=wu:fi35a05 PE=2 SV=1
14	Q98950	2.05e-19	91.7	373	0.081	0.099	Q98950_CHICK CVg1 protein OS=Gallus gallus OX=9031 GN=cVg1 PE=2 SV=1
15	G5EEL5	1.66e-18	89.0	365	0.084	0.104	DBL1_CAEEL Protein dbl-1 OS=Caenorhabditis elegans OX=6239 GN=dbl-1 PE=1 SV=1
16	O13109	3.40e-18	88.2	386	0.081	0.096	O13109_DANRE BMP2 OS=Danio rerio OX=7955 GN=BMP2 PE=2 SV=1
17	P35621	7.44e-18	87.0	355	0.075	0.096	DVR1_DANRE Protein DVR-1 OS=Danio rerio OX=7955 GN=dvr1 PE=2 SV=1
18	P49001	2.37e-17	85.9	393	0.077	0.089	BMP2_RAT Bone morphogenetic protein 2 OS=Rattus norvegicus OX=10116 GN=Bmp2 PE=2 SV=1
19	P21274	2.93e-17	85.5	394	0.077	0.089	BMP2_MOUSE Bone morphogenetic protein 2 OS=Mus musculus OX=10090 GN=Bmp2 PE=1 SV=3
20	C8C060	3.11e-17	85.5	396	0.077	0.088	C8C060_HUMAN Bone morphogenetic protein 2 OS=Homo sapiens OX=9606 GN=BMP2 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00019 TGF_beta	2e-23	94.6	Transforming growth factor beta like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000367942

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363708	0.991	Bone morphogenetic protein receptor type-2
2	9606.ENSP00000329803	0.914	Zygote arrest protein 1
3	9606.ENSP00000364133	0.888	TGF-beta receptor type-1
4	9606.ENSP00000221496	0.879	Muellerian-inhibiting factor
5	9606.ENSP00000419457	0.856	Homeobox protein NOBOX
6	9606.ENSP00000378326	0.851	Zona pellucida sperm-binding protein 3
7	9606.ENSP00000333097	0.826	Factor in the germline alpha
8	9606.ENSP00000401907	0.826	Bone morphogenetic protein receptor type-1B
9	9606.ENSP00000392936	0.815	Ret finger protein like 4A
10	9606.ENSP00000318650	0.790	Gremlin-2
11	9606.ENSP00000384708	0.781	Follicle-stimulating hormone receptor
12	9606.ENSP00000228280	0.774	Kit ligand
13	9606.ENSP00000333188	0.756	Forkhead box protein L2
14	9606.ENSP00000243786	0.751	Inhibin alpha chain
15	9606.ENSP00000250863	0.742	Deleted in azoospermia-like
16	9606.ENSP00000294954	0.728	Lutropin-choriogonadotropic hormone receptor
17	9606.ENSP00000460971	0.726	Zona pellucida sperm-binding protein 2
18	9606.ENSP00000262753	0.723	Protein POF1B
19	9606.ENSP00000319799	0.705	Histone H1oo
20	9606.ENSP00000375063	0.700	NACHT, LRR and PYD domains-containing protein 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008083	1.000	growth factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.989	regulation of cellular process
GO:0032501	0.988	multicellular organismal process
GO:0009987	0.987	cellular process
GO:0000003	0.985	reproduction
GO:0032502	0.981	developmental process
GO:0048522	0.980	positive regulation of cellular process
GO:0022414	0.964	reproductive process
GO:0048856	0.952	anatomical structure development
GO:0060255	0.940	regulation of macromolecule metabolic process
GO:0007275	0.938	multicellular organism development
GO:0003006	0.924	developmental process involved in reproduction
GO:0080090	0.920	regulation of primary metabolic process
GO:0007548	0.903	sex differentiation
GO:0023051	0.878	regulation of signaling
GO:0010646	0.878	regulation of cell communication
GO:0019953	0.868	sexual reproduction
GO:0030154	0.865	cell differentiation
GO:0007276	0.849	gamete generation
GO:0050793	0.842	regulation of developmental process
GO:0051171	0.824	regulation of nitrogen compound metabolic process
GO:0031323	0.801	regulation of cellular metabolic process
GO:0051239	0.755	regulation of multicellular organismal process
GO:0050896	0.753	response to stimulus
GO:0009893	0.750	positive regulation of metabolic process
GO:0046660	0.747	female sex differentiation
GO:0008406	0.745	gonad development
GO:0009966	0.737	regulation of signal transduction
GO:0031325	0.711	positive regulation of cellular metabolic process
GO:0045595	0.681	regulation of cell differentiation
GO:0010604	0.681	positive regulation of macromolecule metabolic process
GO:0023056	0.676	positive regulation of signaling
GO:0010647	0.676	positive regulation of cell communication
GO:2000241	0.671	regulation of reproductive process
GO:0051173	0.659	positive regulation of nitrogen compound metabolic process
GO:1902531	0.622	regulation of intracellular signal transduction
GO:0008585	0.618	female gonad development
GO:0022602	0.608	ovulation cycle process
GO:0048584	0.596	positive regulation of response to stimulus
GO:0007292	0.594	female gamete generation
GO:0048519	0.567	negative regulation of biological process
GO:0051716	0.517	cellular response to stimulus
GO:0007167	0.486	enzyme-linked receptor protein signaling pathway
GO:0048523	0.480	negative regulation of cellular process
GO:0070848	0.477	response to growth factor
GO:0048468	0.457	cell development
GO:0071363	0.453	cellular response to growth factor stimulus
GO:0009889	0.424	regulation of biosynthetic process
GO:0010468	0.399	regulation of gene expression
GO:0007178	0.387	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0022412	0.370	cellular process involved in reproduction in multicellular organism
GO:0007281	0.364	germ cell development
GO:0031326	0.360	regulation of cellular biosynthetic process
GO:0009967	0.357	positive regulation of signal transduction
GO:0019219	0.348	regulation of nucleobase-containing compound metabolic process
GO:0040007	0.347	growth
GO:0042127	0.345	regulation of cell population proliferation
GO:0051174	0.336	regulation of phosphorus metabolic process
GO:0042325	0.331	regulation of phosphorylation
GO:0010556	0.327	regulation of macromolecule biosynthetic process
GO:0051246	0.306	regulation of protein metabolic process
GO:0008152	0.305	metabolic process
GO:0006355	0.305	regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043226	0.624	organelle
GO:0043227	0.565	membrane-bounded organelle
GO:0043229	0.560	intracellular organelle
GO:0043231	0.523	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]