StarFunc result for job id O60391

User Input

>input (1043 residues)
MEFVRALWLGLALALGPGSAGGHPQPCGVLARLGGSVRLGALLPRAPLARARARAALARA
ALAPRLPHNLSLELVVAAPPARDPASLTRGLCQALVPPGVAALLAFPEARPELLQLHFLA
AATETPVLSLLRREARAPLGAPNPFHLQLHWASPLETLLDVLVAVLQAHAWEDVGLALCR
TQDPGGLVALWTSRAGRPPQLVLDLSRRDTGDAGLRARLAPMAAPVGGEAPVPAAVLLGC
DIARARRVLEAVPPGPHWLLGTPLPPKALPTAGLPPGLLALGEVARPPLEAAIHDIVQLV
ARALGSAAQVQPKRALLPAPVNCGDLQPAGPESPGRFLARFLANTSFQGRTGPVWVTGSS
QVHMSRHFKVWSLRRDPRGAPAWATVGSWRDGQLDLEPGGASARPPPPQGAQVWPKLRVV
TLLEHPFVFARDPDEDGQCPAGQLCLDPGTNDSATLDALFAALANGSAPRALRKCCYGYC
IDLLERLAEDTPFDFELYLVGDGKYGALRDGRWTGLVGDLLAGRAHMAVTSFSINSARSQ
VVDFTSPFFSTSLGIMVRARDTASPIGAFMWPLHWSTWLGVFAALHLTALFLTVYEWRSP
YGLTPRGRNRSTVFSYSSALNLCYAILFRRTVSSKTPKCPTGRLLMNLWAIFCLLVLSSY
TANLAAVMVGDKTFEELSGIHDPKLHHPAQGFRFGTVWESSAEAYIKKSFPDMHAHMRRH
SAPTTPRGVAMLTSDPPKLNAFIMDKSLLDYEVSIDADCKLLTVGKPFAIEGYGIGLPQN
SPLTSNLSEFISRYKSSGFIDLLHDKWYKMVPCGKRVFAVTETLQMSIYHFAGLFVLLCL
GLGSALLSSLGEHAFFRLALPRIRKGSRLQYWLHTSQKIHRALNTEPPEGSKEETAEAEP
SGPEVEQQQQQQDQPTAPEGWKRARRAVDKERRVRFLLEPAVVVAPEADAEAEAAPREGP
VWLCSYGRPPAARPTGAPQPGELQELERRIEVARERLRQALVRRGQLLAQLGDSARHRPR
RLLQARAAPAEAPPHSGRPGSQE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60391	1.000	1.000	0.000	1043	1.000	1.000	O60391.pdb.gz	NMD3B_HUMAN Glutamate receptor ionotropic, NMDA 3B OS=Homo sapiens OX=9606 GN=GRIN3B PE=2 SV=2
2	AFDB:Q91ZU9	0.820	0.851	0.000	1003	0.766	0.797	Q91ZU9.pdb.gz	NMD3B_MOUSE Glutamate receptor ionotropic, NMDA 3B OS=Mus musculus OX=10090 GN=Grin3b PE=1 SV=1
3	AFDB:Q14957	0.342	0.294	1.346E-62	1233	0.257	0.217	Q14957.pdb.gz	NMDE3_HUMAN Glutamate receptor ionotropic, NMDA 2C OS=Homo sapiens OX=9606 GN=GRIN2C PE=1 SV=3
4	AFDB:P35438	0.601	0.659	1.555E-61	938	0.225	0.251	P35438.pdb.gz	NMDZ1_MOUSE Glutamate receptor ionotropic, NMDA 1 OS=Mus musculus OX=10090 GN=Grin1 PE=1 SV=1
5	AFDB:B7ZSK1	0.352	0.263	1.942E-61	1451	0.213	0.153	B7ZSK1.pdb.gz	NMDE1_XENLA Glutamate receptor ionotropic, NMDA 2A OS=Xenopus laevis OX=8355 GN=grin2a PE=1 SV=1
6	AFDB:Q9W581	0.521	0.505	4.000E-61	1083	0.208	0.200	Q9W581.pdb.gz	Q9W581_DROME NMDA receptor 2, isoform C OS=Drosophila melanogaster OX=7227 GN=Nmdar2 PE=2 SV=2
7	AFDB:Q24418	0.617	0.642	2.448E-59	997	0.211	0.221	Q24418.pdb.gz	NMDA1_DROME Glutamate [NMDA] receptor subunit 1 OS=Drosophila melanogaster OX=7227 GN=Nmdar1 PE=1 SV=1
8	AFDB:O76903	0.378	0.389	2.529E-58	1012	0.213	0.219	O76903.pdb.gz	O76903_DROME EG:80H7.7 protein OS=Drosophila melanogaster OX=7227 GN=Nmdar2 PE=3 SV=1
9	AFDB:G5EGQ9	0.573	0.581	1.034E-53	1025	0.190	0.193	G5EGQ9.pdb.gz	G5EGQ9_CAEEL LITAF domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=nmr-1 PE=2 SV=1
10	PDB:4tllA	0.494	0.631	1.485E-47	767	0.189	0.257	4tllA.pdb.gz	NMDA receptor structures reveal subunit arrangement and pore architecture.
11	AFDB:B3DGZ2	0.423	0.480	2.590E-47	898	0.178	0.207	B3DGZ2.pdb.gz
12	PDB:7rz4A	0.347	0.361	7.872E-47	993	0.173	0.181	7rz4A.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
13	PDB:4pe5C	0.489	0.634	4.173E-46	754	0.187	0.259	4pe5C.pdb.gz	Crystal structure of a heterotetrameric NMDA receptor ion channel.
14	PDB:7ocaA	0.317	0.402	3.648E-45	775	0.167	0.225	7ocaA.pdb.gz	Gating and modulation of a hetero-octameric AMPA glutamate receptor.
15	PDB:7rzaA	0.314	0.330	2.554E-44	981	0.177	0.189	7rzaA.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
16	PDB:4tlmC	0.481	0.622	5.562E-44	750	0.176	0.245	4tlmC.pdb.gz	NMDA receptor structures reveal subunit arrangement and pore architecture.
17	PDB:5idfB	0.267	0.360	8.759E-42	734	0.165	0.234	5idfB.pdb.gz
18	PDB:4u1xC	0.345	0.448	2.815E-41	755	0.166	0.229	4u1xC.pdb.gz	Structure and Dynamics of AMPA Receptor GluA2 in Resting, Pre-Open, and Desensitized States.
19	PDB:5iouA	0.553	0.688	6.482E-41	803	0.198	0.258	5iouA.pdb.gz	Mechanism of NMDA Receptor Inhibition and Activation.
20	PDB:5kbtA	0.331	0.351	6.852E-41	973	0.170	0.182	5kbtA.pdb.gz	Elucidation of AMPA receptor-stargazin complexes by cryo-electron microscopy.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2AIR5	0.0	983	1135	0.478	0.440	NMD3A_MOUSE Glutamate receptor ionotropic, NMDA 3A OS=Mus musculus OX=10090 GN=Grin3a PE=1 SV=1
2	O60391	0.0	2084	1043	1.000	1.000	NMD3B_HUMAN Glutamate receptor ionotropic, NMDA 3B OS=Homo sapiens OX=9606 GN=GRIN3B PE=2 SV=2
3	Q8TCU5	0.0	982	1115	0.495	0.463	NMD3A_HUMAN Glutamate receptor ionotropic, NMDA 3A OS=Homo sapiens OX=9606 GN=GRIN3A PE=1 SV=2
4	Q8VHN2	0.0	1501	1002	0.766	0.797	NMD3B_RAT Glutamate receptor ionotropic, NMDA 3B OS=Rattus norvegicus OX=10116 GN=Grin3b PE=1 SV=2
5	Q91ZU9	0.0	1490	1003	0.751	0.781	NMD3B_MOUSE Glutamate receptor ionotropic, NMDA 3B OS=Mus musculus OX=10090 GN=Grin3b PE=1 SV=1
6	Q9R1M7	0.0	983	1135	0.478	0.440	NMD3A_RAT Glutamate receptor ionotropic, NMDA 3A OS=Rattus norvegicus OX=10116 GN=Grin3a PE=1 SV=1
7	Q00960	9.81e-81	291	1482	0.227	0.160	NMDE2_RAT Glutamate receptor ionotropic, NMDA 2B OS=Rattus norvegicus OX=10116 GN=Grin2b PE=1 SV=1
8	Q01097	1.14e-80	290	1482	0.225	0.159	NMDE2_MOUSE Glutamate receptor ionotropic, NMDA 2B OS=Mus musculus OX=10090 GN=Grin2b PE=1 SV=3
9	Q13224	1.19e-80	290	1484	0.226	0.159	NMDE2_HUMAN Glutamate receptor ionotropic, NMDA 2B OS=Homo sapiens OX=9606 GN=GRIN2B PE=1 SV=3
10	Q14957	8.80e-78	280	1233	0.248	0.210	NMDE3_HUMAN Glutamate receptor ionotropic, NMDA 2C OS=Homo sapiens OX=9606 GN=GRIN2C PE=1 SV=3
11	Q01098	1.21e-77	280	1239	0.246	0.207	NMDE3_MOUSE Glutamate receptor ionotropic, NMDA 2C OS=Mus musculus OX=10090 GN=Grin2c PE=1 SV=2
12	P35436	6.29e-77	279	1464	0.227	0.162	NMDE1_MOUSE Glutamate receptor ionotropic, NMDA 2A OS=Mus musculus OX=10090 GN=Grin2a PE=1 SV=2
13	Q00959	8.75e-77	279	1464	0.228	0.163	NMDE1_RAT Glutamate receptor ionotropic, NMDA 2A OS=Rattus norvegicus OX=10116 GN=Grin2a PE=1 SV=2
14	X2JDW0	1.37e-76	275	1082	0.219	0.211	X2JDW0_DROME NMDA receptor 2, isoform G OS=Drosophila melanogaster OX=7227 GN=Nmdar2 PE=3 SV=1
15	Q9W581	1.63e-76	275	1083	0.219	0.211	Q9W581_DROME NMDA receptor 2, isoform C OS=Drosophila melanogaster OX=7227 GN=Nmdar2 PE=2 SV=2
16	Q6IWN7	1.98e-76	275	1070	0.218	0.212	Q6IWN7_DROME NMDA receptor 2, isoform F OS=Drosophila melanogaster OX=7227 GN=Nmdar2 PE=2 SV=1
17	Q8MM14	2.81e-76	271	902	0.202	0.234	Q8MM14_DROME Glutamate NMDA receptor subunit variant NR2-a OS=Drosophila melanogaster OX=7227 GN=Nmdar2 PE=2 SV=1
18	Q00961	3.83e-76	276	1237	0.239	0.201	NMDE3_RAT Glutamate receptor ionotropic, NMDA 2C OS=Rattus norvegicus OX=10116 GN=Grin2c PE=1 SV=1
19	Q8MX77	4.98e-76	270	841	0.194	0.240	Q8MX77_DROME NMDA receptor 2 OS=Drosophila melanogaster OX=7227 GN=Nmdar2 PE=2 SV=1
20	E1JJC6	7.70e-76	271	941	0.202	0.224	E1JJC6_DROME NMDA receptor 2, isoform E OS=Drosophila melanogaster OX=7227 GN=Nmdar2 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01094 ANF_receptor	13	16.4	Receptor family ligand binding region
2	PF00060 Lig_chan	1.2e-24	98.4	Ligand-gated ion channel
3	PF10613 Lig_chan-Glu_bd	8e-23	92.2	Ligated ion channel L-glutamate- and glycine-binding site
4	PF00497 SBP_bac_3	1.4e-15	68.9	Bacterial extracellular solute-binding proteins, family 3

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000234389

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360608	0.938	Glutamate receptor ionotropic, NMDA 1
2	9606.ENSP00000379818	0.925	Glutamate receptor ionotropic, NMDA 2A
3	9606.ENSP00000382428	0.923	Disks large homolog 4
4	9606.ENSP00000477455	0.856	Glutamate receptor ionotropic, NMDA 2B
5	9606.ENSP00000300105	0.830	Voltage-dependent calcium channel gamma-2 subunit
6	9606.ENSP00000349087	0.818	Membralin
7	9606.ENSP00000440185	0.818	Proenkephalin-B
8	9606.ENSP00000282499	0.807	Glutamate receptor 4
9	9606.ENSP00000263269	0.805	Glutamate receptor ionotropic, NMDA 2D
10	9606.ENSP00000293190	0.804	Glutamate receptor ionotropic, NMDA 2C
11	9606.ENSP00000375647	0.803	Voltage-dependent calcium channel gamma-7 subunit
12	9606.ENSP00000428994	0.798	Glutamate receptor 1
13	9606.ENSP00000481554	0.794	Glutamate receptor 3
14	9606.ENSP00000296526	0.791	Glutamate receptor 2
15	9606.ENSP00000005284	0.783	Voltage-dependent calcium channel gamma-3 subunit
16	9606.ENSP00000262138	0.780	Voltage-dependent calcium channel gamma-4 subunit
17	9606.ENSP00000436836	0.779	Voltage-dependent calcium channel gamma-5 subunit
18	9606.ENSP00000272133	0.776	Protein cornichon homolog 3
19	9606.ENSP00000270458	0.774	Voltage-dependent calcium channel gamma-8 subunit
20	9606.ENSP00000310003	0.768	Protein cornichon homolog 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0022890	0.999	inorganic cation transmembrane transporter activity
GO:0004970	0.996	ionotropic glutamate receptor activity
GO:0005261	0.993	monoatomic cation channel activity
GO:0005488	0.990	binding
GO:0099507	0.989	ligand-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential
GO:0005515	0.972	protein binding
GO:0046873	0.957	metal ion transmembrane transporter activity
GO:1901702	0.954	salt transmembrane transporter activity
GO:0005244	0.674	voltage-gated monoatomic ion channel activity
GO:0004972	0.589	NMDA glutamate receptor activity
GO:0099094	0.564	ligand-gated monoatomic cation channel activity
GO:0005262	0.349	calcium channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0065007	0.995	biological regulation
GO:0050794	0.986	regulation of cellular process
GO:0023052	0.941	signaling
GO:0007154	0.925	cell communication
GO:0050896	0.914	response to stimulus
GO:0051179	0.908	localization
GO:0051716	0.875	cellular response to stimulus
GO:0007165	0.810	signal transduction
GO:0007166	0.629	cell surface receptor signaling pathway
GO:0051234	0.506	establishment of localization
GO:0007215	0.486	glutamate receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031090	0.998	organelle membrane
GO:0098797	0.997	plasma membrane protein complex
GO:0034702	0.997	ion channel complex
GO:0031984	0.996	organelle subcompartment
GO:0005783	0.996	endoplasmic reticulum
GO:0005789	0.992	endoplasmic reticulum membrane
GO:0008328	0.985	ionotropic glutamate receptor complex
GO:0017146	0.948	NMDA selective glutamate receptor complex
GO:0036477	0.747	somatodendritic compartment
GO:0045202	0.735	synapse
GO:0098794	0.578	postsynapse
GO:0098590	0.543	plasma membrane region
GO:0045211	0.527	postsynaptic membrane
GO:0044297	0.484	cell body
GO:0043025	0.448	neuronal cell body
GO:0098984	0.433	neuron to neuron synapse
GO:0099572	0.392	postsynaptic specialization
GO:0098793	0.387	presynapse
GO:0032279	0.369	asymmetric synapse
GO:0070013	0.357	intracellular organelle lumen
GO:0014069	0.355	postsynaptic density

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	0.349	Ca(2+)(in) = Ca(2+)(out)

[back to server]