StarFunc result for job id O60423

User Input

>input (1300 residues)
MGTGPAQTPRSTRAGPEPSPAPPGPGDTGDSDVTQEGSGPAGIRGGETVIRAGMGDSPGR
GAPERRHKAQPGRARKYEWRPEGPTSMGSLGQREDLQDEDRNSAFTWKVQANNRAYNGQF
KEKVILCWQRKKYKTNVIRTAKYNFYSFLPLNLYEQFHRVSNLFFLIIIILQSIPDISTL
PWFSLSTPMVCLLFIRATRDLVDDMGRHKSDRAINNRPCQILMGKSFKQKKWQDLCVGDV
VCLRKDNIVPADMLLLASTEPSSLCYVETVDIDGETNLKFRQALMVTHKELATIKKMASF
QGTVTCEAPNSRMHHFVGCLEWNDKKYSLDIGNLLLRGCRIRNTDTCYGLVIYAGFDTKI
MKNCGKIHLKRTKLDLLMNKLVVVIFISVVLVCLVLAFGFGFSVKEFKDHHYYLSGVHGS
SVAAESFFVFWSFLILLSVTIPMSMFILSEFIYLGNSVFIDWDVQMYYKPQDVPAKARST
SLNDHLGQVEYIFSDKTGTLTQNILTFNKCCISGRVYGPDSEATTRPKENPYLWNKFADG
KLLFHNAALLHLVRTNGDEAVREFWRLLAICHTVMVRESPRERPDQLLYQAASPDEGALV
TAARNFGYVFLSRTQDTVTIMELGEERVYQVLAIMDFNSTRKRMSVLVRKPEGAICLYTK
GADTVIFERLHRRGAMEFATEEALAAFAQETLRTLCLAYREVAEDIYEDWQQRHQEASLL
LQNRAQALQQLLGATAIEDRLQDGVPETIKCLKKSNIKIWVLTGDKQETAVNIGFACELL
SENMLILEEKEISRILETYWENSNNLLTRESLSQVKLALVINGDFLDKLLVSLRKEPRAL
AQNVNMDEAWQELGQSRRDFLYARRLSLLCRRFGLPLAAPPAQDSRARRSSEVLQERAFV
DLASKCQAVICCRVTPKQKALIVALVKKYHQVVTLAIGDGANDINMIKTADVGVGLAGQE
GMQAVQNSDFVLGQFCFLQRLLLVHGRWSYVRICKFLRYFFYKSMASMMVQVWFACYNGF
TGQPLYEGWFLALFNLLYSTLPVLYIGLFEQDVSAEQSLEKPELYVVGQKDELFNYWVFV
QAIAHGVTTSLVNFFMTLWISRDTAGPASFSDHQSFAVVVALSCLLSITMEVILIIKYWT
ALCVATILLSLGFYAIMTTTTQSFWLFRVSPTTFPFLYADLSVMSSPSILLVVLLSVSIN
TFPVLALRVIFPALKELRAKEEKVEEGPSEEIFTMEPLPHVHRESRARRSSYAFSHREGY
ANLITQGTILRRGPGVSSDIASESLDPSDEEAASSPKESQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7py4A	0.773	0.901	0.000	1112	0.411	0.480	7py4A.pdb.gz	Autoinhibition and regulation by phosphoinositides of ATP8B1, a human lipid flippase associated with intrahepatic cholestatic disorders.
2	AFDB:A3FIN4	0.784	0.861	0.000	1183	0.380	0.418	A3FIN4.pdb.gz	AT8B5_MOUSE Phospholipid-transporting ATPase FetA OS=Mus musculus OX=10090 GN=Atp8b5 PE=2 SV=1
3	AFDB:D4AA47	0.804	0.835	0.000	1251	0.432	0.449	D4AA47.pdb.gz	AT8B1_RAT Phospholipid-transporting ATPase IC OS=Rattus norvegicus OX=10116 GN=Atp8b1 PE=1 SV=2
4	AFDB:P98198	0.784	0.842	0.000	1209	0.407	0.438	P98198.pdb.gz	AT8B2_HUMAN Phospholipid-transporting ATPase ID OS=Homo sapiens OX=9606 GN=ATP8B2 PE=1 SV=2
5	AFDB:Q6UQ17	0.867	0.845	0.000	1335	0.651	0.634	Q6UQ17.pdb.gz	AT8B3_MOUSE Phospholipid-transporting ATPase IK OS=Mus musculus OX=10090 GN=Atp8b3 PE=1 SV=1
6	AFDB:Q8TF62	0.799	0.870	0.000	1192	0.390	0.425	Q8TF62.pdb.gz	AT8B4_HUMAN Probable phospholipid-transporting ATPase IM OS=Homo sapiens OX=9606 GN=ATP8B4 PE=1 SV=3
7	AFDB:Q7YXV5	0.790	0.808	5.245E-103	1270	0.359	0.368	Q7YXV5.pdb.gz	Q7YXV5_CAEEL Phospholipid-transporting ATPase OS=Caenorhabditis elegans OX=6239 GN=tat-2 PE=1 SV=2
8	PDB:7vghB	0.803	0.881	2.063E-99	1183	0.428	0.470	7vghB.pdb.gz	Structural insights into the activation of autoinhibited human lipid flippase ATP8B1 upon substrate binding.
9	AFDB:Q9NTI2	0.762	0.832	2.470E-93	1188	0.322	0.352	Q9NTI2.pdb.gz	AT8A2_HUMAN Phospholipid-transporting ATPase IB OS=Homo sapiens OX=9606 GN=ATP8A2 PE=1 SV=3
10	AFDB:O94296	0.744	0.768	2.585E-93	1258	0.324	0.335	O94296.pdb.gz	ATC3_SCHPO Phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC887.12 PE=3 SV=1
11	AFDB:P70704	0.763	0.849	8.429E-93	1164	0.318	0.355	P70704.pdb.gz	AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus OX=10090 GN=Atp8a1 PE=1 SV=2
12	AFDB:P39524	0.761	0.732	2.291E-92	1355	0.337	0.323	P39524.pdb.gz	ATC3_YEAST Phospholipid-transporting ATPase DRS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DRS2 PE=1 SV=2
13	PDB:6rohA	0.741	0.862	1.957E-82	1112	0.322	0.377	6rohA.pdb.gz	Structure and autoregulation of a P4-ATPase lipid flippase.
14	PDB:7kycA	0.745	0.819	1.322E-78	1178	0.294	0.324	7kycA.pdb.gz	Transport mechanism of P4 ATPase phosphatidylcholine flippases.
15	PDB:7kyaA	0.735	0.811	1.542E-74	1174	0.285	0.316	7kyaA.pdb.gz	Transport mechanism of P4 ATPase phosphatidylcholine flippases.
16	PDB:6k7lA	0.678	0.880	1.432E-70	992	0.289	0.379	6k7lA.pdb.gz	Cryo-EM structures capture the transport cycle of the P4-ATPase flippase.
17	PDB:7bspA	0.589	0.725	5.209E-63	1028	0.252	0.318	7bspA.pdb.gz	Transport Cycle of Plasma Membrane Flippase ATP11C by Cryo-EM.
18	PDB:7rd6A	0.665	0.919	1.438E-61	929	0.210	0.294	7rd6A.pdb.gz	Structural basis of the P4B ATPase lipid flippase activity.
19	PDB:6lknA	0.683	0.826	9.567E-59	1064	0.251	0.306	6lknA.pdb.gz	Crystal structure of a human plasma membrane phospholipid flippase.
20	PDB:7bssA	0.531	0.814	4.380E-45	816	0.190	0.303	7bssA.pdb.gz	Transport Cycle of Plasma Membrane Flippase ATP11C by Cryo-EM.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A5K1VW70	936	1190	0.403	0.440	A0A5K1VW70_HUMAN Phospholipid-transporting ATPase OS=Homo sapiens OX=9606 GN=ATP8B2 PE=1 SV=1
2	A0A8I5ZKC1	607	985	0.286	0.378	A0A8I5ZKC1_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=1
3	A0A8I5ZXX6	715	1164	0.319	0.357	A0A8I5ZXX6_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=1
4	A0A8I6AVY6	721	1164	0.321	0.358	A0A8I6AVY6_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=1
5	A0A8I6G2I8	607	978	0.285	0.379	A0A8I6G2I8_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=1
6	A3FIN4	899	1183	0.392	0.431	AT8B5_MOUSE Phospholipid-transporting ATPase FetA OS=Mus musculus OX=10090 GN=Atp8b5 PE=2 SV=1
7	C7EXK4	708	1148	0.308	0.348	AT8A2_BOVIN Phospholipid-transporting ATPase IB OS=Bos taurus OX=9913 GN=ATP8A2 PE=1 SV=4
8	D4A3X6	712	1169	0.306	0.340	D4A3X6_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a2 PE=1 SV=3
9	D4AA47	1092	1251	0.434	0.451	AT8B1_RAT Phospholipid-transporting ATPase IC OS=Rattus norvegicus OX=10116 GN=Atp8b1 PE=1 SV=2
10	F1LUT4	609	984	0.288	0.380	F1LUT4_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=4
11	F4IE35	620	1185	0.290	0.318	F4IE35_ARATH Phospholipid-transporting ATPase OS=Arabidopsis thaliana OX=3702 GN=At1g26130 PE=1 SV=1
12	O43520	1093	1251	0.433	0.450	AT8B1_HUMAN Phospholipid-transporting ATPase IC OS=Homo sapiens OX=9606 GN=ATP8B1 PE=1 SV=3
13	O94296	677	1258	0.315	0.326	ATC3_SCHPO Phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC887.12 PE=3 SV=1
14	P39524	649	1355	0.298	0.286	ATC3_YEAST Phospholipid-transporting ATPase DRS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DRS2 PE=1 SV=2
15	P70704	716	1164	0.320	0.357	AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus OX=10090 GN=Atp8a1 PE=1 SV=2
16	P98198	936	1209	0.403	0.433	AT8B2_HUMAN Phospholipid-transporting ATPase ID OS=Homo sapiens OX=9606 GN=ATP8B2 PE=1 SV=2
17	P98199	931	1209	0.402	0.433	AT8B2_MOUSE Phospholipid-transporting ATPase ID OS=Mus musculus OX=10090 GN=Atp8b2 PE=1 SV=2
18	P98200	706	1148	0.304	0.344	AT8A2_MOUSE Phospholipid-transporting ATPase IB OS=Mus musculus OX=10090 GN=Atp8a2 PE=1 SV=1
19	P98204	588	1158	0.282	0.317	ALA1_ARATH Phospholipid-transporting ATPase 1 OS=Arabidopsis thaliana OX=3702 GN=ALA1 PE=2 SV=1
20	Q148W0	1096	1251	0.436	0.453	AT8B1_MOUSE Phospholipid-transporting ATPase IC OS=Mus musculus OX=10090 GN=Atp8b1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13246 Cation_ATPase	1.3e-08	46.0	Cation transport ATPase (P-type)
2	PF00122 E1-E2_ATPase	0.00029	31.9	E1-E2 ATPase
3	PF00702 Hydrolase	2.3e-07	42.9	haloacid dehalogenase-like hydrolase
4	PF08282 Hydrolase_3	2.7	19.2	haloacid dehalogenase-like hydrolase
5	PF16212 PhoLip_ATPase_C	3.9e-66	234.9	Phospholipid-translocating P-type ATPase C-terminal
6	PF16209 PhoLip_ATPase_N	2.8e-21	86.3	Phospholipid-translocating ATPase N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000311336

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000230461	0.874	Cell cycle control protein 50A
2	9606.ENSP00000419663	0.770	Cell cycle control protein 50C
3	9606.ENSP00000450842	0.755	Cell cycle control protein 50B
4	9606.ENSP00000353557	0.722	Solute carrier family 35 member F1
5	9606.ENSP00000232892	0.710	Arylacetamide deacetylase
6	9606.ENSP00000310803	0.642	Vesicle transport protein SFT2C
7	9606.ENSP00000427661	0.617	Anion exchange protein 4
8	9606.ENSP00000194130	0.600	Solute carrier family 13 member 1
9	9606.ENSP00000264758	0.588	Alpha-adducin
10	9606.ENSP00000365773	0.570	Phosphoserine aminotransferase
11	9606.ENSP00000299886	0.516	Conserved oligomeric Golgi complex subunit 1
12	9606.ENSP00000355736	0.516	Tctex1 domain-containing protein 3
13	9606.ENSP00000260257	0.514	Ferredoxin-fold anticodon-binding domain-containing protein 1
14	9606.ENSP00000184183	0.512	Ropporin-1A
15	9606.ENSP00000433761	0.502	Membrane-spanning 4-domains subfamily A member 14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0140333	0.998	glycerophospholipid flippase activity
GO:0008525	0.989	phosphatidylcholine transporter activity
GO:0015247	0.522	aminophospholipid flippase activity
GO:0140345	0.399	phosphatidylcholine flippase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0065007	0.985	biological regulation
GO:0006810	0.961	transport
GO:0050794	0.943	regulation of cellular process
GO:0033036	0.680	macromolecule localization
GO:0071702	0.548	organic substance transport
GO:0071840	0.529	cellular component organization or biogenesis
GO:0016043	0.508	cellular component organization
GO:0065008	0.450	regulation of biological quality
GO:0048518	0.331	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0016020	0.999	membrane
GO:0012505	0.999	endomembrane system
GO:0031982	0.752	vesicle
GO:0031410	0.599	cytoplasmic vesicle
GO:0005886	0.566	plasma membrane
GO:0005634	0.486	nucleus
GO:0043233	0.372	organelle lumen
GO:0005829	0.359	cytosol
GO:0070013	0.356	intracellular organelle lumen
GO:0031981	0.317	nuclear lumen
GO:0032991	0.301	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.6.2.1	0.999	P-type phospholipid transporter.

[back to server]