StarFunc result for job id O60437

User Input

>input (1756 residues)
MNSLFRKRNKGKYSPTVQTRSISNKELSELIEQLQKNADQVEKNIVDTEAKMQSDLARLQ
EGRQPEHRDVTLQKVLDSEKLLYVLEADAAIAKHMKHPQGDMIAEDIRQLKERVTNLRGK
HKQIYRLAVKEVDPQVNWAALVEEKLDKLNNQSFGTDLPLVDHQVEEHNIFHNEVKAIGP
HLAKDGDKEQNSELRAKYQKLLAASQARQQHLSSLQDYMQRCTNELYWLDQQAKGRMQYD
WSDRNLDYPSRRRQYENFINRNLEAKEERINKLHSEGDQLLAAEHPGRNSIEAHMEAVHA
DWKEYLNLLICEESHLKYMEDYHQFHEDVKDAQELLRKVDSDLNQKYGPDFKDRYQIELL
LRELDDQEKVLDKYEDVVQGLQKRGQQVVPLKYRRETPLKPIPVEALCDFEGEQGLISRG
YSYTLQKNNGESWELMDSAGNKLIAPAVCFVIPPTDPEALALADSLGSQYRSVRQKAAGS
KRTLQQRYEVLKTENPGDASDLQGRQLLAGLDKVASDLDRQEKAITGILRPPLEQGRAVQ
DSAERAKDLKNITNELLRIEPEKTRSTAEGEAFIQALPGSGTTPLLRTRVEDTNRKYEHL
LQLLDLAQEKVDVANRLEKSLQQSWELLATHENHLNQDDTVPESSRVLDSKGQELAAMAC
ELQAQKSLLGEVEQNLQAAKQCSSTLASRFQEHCPDLERQEAEVHKLGQRFNNLRQQVER
RAQSLQSAKAAYEHFHRGHDHVLQFLVSIPSYEPQETDSLSQMETKLKNQKNLLDEIASR
EQEVQKICANSQQYQQAVKDYELEAEKLRSLLDLENGRRSHVSKRARLQSPATKVKEEEA
ALAAKFTEVYAINRQRLQNLEFALNLLRQQPEVEVTHETLQRNRPDSGVEEAWKIRKELD
EETERRRQLENEVKSTQEEIWTLRNQGPQESVVRKEVLKKVPDPVLEESFQQLQRTLAEE
QHKNQLLQEELEALQLQLRALEQETRDGGQEYVVKEVLRIEPDRAQADEVLQLREELEAL
RRQKGAREAEVLLLQQRVAALAEEKSRAQEKVTEKEVVKLQNDPQLEAEYQQLQEDHQRQ
DQLREKQEEELSFLQDKLKRLEKERAMAEGKITVKEVLKVEKDAATEREVSDLTRQYEDE
AAKARASQREKTELLRKIWALEEENAKVVVQEKVREIVRPDPKAESEVANLRLELVEQER
KYRGAEEQLRSYQSELEALRRRGPQVEVKEVTKEVIKYKTDPEMEKELQRLREEIVDKTR
LIERCDLEIYQLKKEIQALKDTKPQVQTKEVVQEILQFQEDPQTKEEVASLRAKLSEEQK
KQVDLERERASQEEQIARKEEELSRVKERVVQQEVVRYEEEPGLRAEASAFAESIDVELR
QIDKLRAELRRLQRRRTELERQLEELERERQARREAEREVQRLQQRLAALEQEEAEAREK
VTHTQKVVLQQDPQQAREHALLRLQLEEEQHRRQLLEGELETLRRKLAALEKAEVKEKVV
LSESVQVEKGDTEQEIQRLKSSLEEESRSKRELDVEVSRLEARLSELEFHNSKSSKELDF
LREENHKLQLERQNLQLETRRLQSEINMAATETRDLRNMTVADSGTNHDSRLWSLERELD
DLKRLSKDKDLEIDELQKRLGSVAVKREQRENHLRRSIVVIHPDTGRELSPEEAHRAGLI
DWNMFVKLRSQECDWEEISVKGPNGESSVIHDRKSGKKFSIEEALQSGRLTPAQYDRYVN
KDMSIQELAVLVSGQK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60437	1.000	1.000	0.000	1756	1.000	1.000	O60437.pdb.gz	PEPL_HUMAN Periplakin OS=Homo sapiens OX=9606 GN=PPL PE=1 SV=4
2	AFDB:Q9R269	0.415	0.415	0.000	1755	0.879	0.880	Q9R269.pdb.gz	PEPL_MOUSE Periplakin OS=Mus musculus OX=10090 GN=Ppl PE=1 SV=1
3	AFDB:Q92817	0.220	0.195	1.839E-80	2033	0.300	0.259	Q92817.pdb.gz	EVPL_HUMAN Envoplakin OS=Homo sapiens OX=9606 GN=EVPL PE=1 SV=3
4	AFDB:Q9D952	0.256	0.226	6.030E-80	2035	0.306	0.264	Q9D952.pdb.gz	EVPL_MOUSE Envoplakin OS=Mus musculus OX=10090 GN=Evpl PE=1 SV=3
5	AFDB:Q21408	0.149	0.113	4.331E-14	2432	0.112	0.081	Q21408.pdb.gz	Q21408_CAEEL Spectrin alpha chain OS=Caenorhabditis elegans OX=6239 GN=spc-1 PE=1 SV=2
6	AFDB:P07751	0.143	0.106	3.319E-12	2477	0.135	0.096	P07751.pdb.gz	SPTN1_CHICK Spectrin alpha chain, non-erythrocytic 1 OS=Gallus gallus OX=9031 GN=SPTAN1 PE=1 SV=3
7	AFDB:Q6ZMZ3	0.130	0.208	2.973E-11	975	0.083	0.150	Q6ZMZ3.pdb.gz	SYNE3_HUMAN Nesprin-3 OS=Homo sapiens OX=9606 GN=SYNE3 PE=1 SV=2
8	AFDB:Q01082	0.122	0.104	7.757E-11	2364	0.137	0.102	Q01082.pdb.gz	SPTB2_HUMAN Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2
9	AFDB:Q4FZC9	0.112	0.174	1.148E-9	975	0.083	0.150	Q4FZC9.pdb.gz	SYNE3_MOUSE Nesprin-3 OS=Mus musculus OX=10090 GN=Syne3 PE=1 SV=1
10	AFDB:P11277	0.090	0.078	2.996E-9	2137	0.121	0.099	P11277.pdb.gz	SPTB1_HUMAN Spectrin beta chain, erythrocytic OS=Homo sapiens OX=9606 GN=SPTB PE=1 SV=5
11	PDB:6yvuB	0.046	0.062	7.038E-3	1191	0.072	0.106	6yvuB.pdb.gz
12	PDB:4iggB	0.065	0.109	9.689E-3	771	0.056	0.127	4iggB.pdb.gz
13	PDB:6bfiB	0.052	0.092	1.217E-2	806	0.061	0.133	6bfiB.pdb.gz
14	PDB:7ogtB	0.040	0.087	2.205E-2	708	0.063	0.155	7ogtB.pdb.gz
15	PDB:7usdA	0.059	0.077	3.814E-2	1185	0.069	0.102	7usdA.pdb.gz	Structures reveal a key mechanism of WAVE regulatory complex activation by Rac1 GTPase.
16	PDB:1tr2B	0.048	0.070	6.906E-2	1029	0.072	0.123	1tr2B.pdb.gz
17	PDB:7n6g6A	0.038	0.040	8.678E-2	1558	0.074	0.083	7n6g6A.pdb.gz	Cryo-EM structure of an active central apparatus.
18	PDB:6nr7A	0.045	0.064	1.195E-1	1086	0.058	0.093	6nr7A.pdb.gz	Refined model of chicken vinculin suggests the mechanism of activation by helical super-bundle unfurling
19	PDB:1sjjA	0.110	0.198	1.251E-1	863	0.049	0.100	1sjjA.pdb.gz
20	PDB:6yvuA	0.044	0.062	2.163E-1	1127	0.062	0.097	6yvuA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	K7EKI0	0.0	601	2055	0.310	0.265	K7EKI0_HUMAN Envoplakin OS=Homo sapiens OX=9606 GN=EVPL PE=1 SV=1
2	O60437	0.0	3507	1756	1.000	1.000	PEPL_HUMAN Periplakin OS=Homo sapiens OX=9606 GN=PPL PE=1 SV=4
3	Q92817	0.0	609	2033	0.309	0.267	EVPL_HUMAN Envoplakin OS=Homo sapiens OX=9606 GN=EVPL PE=1 SV=3
4	Q9D952	0.0	647	2035	0.321	0.277	EVPL_MOUSE Envoplakin OS=Mus musculus OX=10090 GN=Evpl PE=1 SV=3
5	Q9R269	0.0	3004	1755	0.880	0.880	PEPL_MOUSE Periplakin OS=Mus musculus OX=10090 GN=Ppl PE=1 SV=1
6	Q91ZU6	1.73e-58	227	7393	0.122	0.029	DYST_MOUSE Dystonin OS=Mus musculus OX=10090 GN=Dst PE=1 SV=2
7	F8W9J4	6.09e-58	225	7461	0.117	0.028	F8W9J4_HUMAN Dystonin OS=Homo sapiens OX=9606 GN=DST PE=1 SV=1
8	Q03001	7.10e-58	225	7570	0.117	0.027	DYST_HUMAN Dystonin OS=Homo sapiens OX=9606 GN=DST PE=1 SV=4
9	A0A2R8PVX9	3.84e-53	209	4580	0.079	0.030	A0A2R8PVX9_DANRE Plectin a OS=Danio rerio OX=7955 GN=fa95h11 PE=1 SV=1
10	E7F8G7	3.84e-53	209	4762	0.079	0.029	E7F8G7_DANRE Plectin a OS=Danio rerio OX=7955 GN=fa95h11 PE=1 SV=1
11	A0A2R8RIJ1	4.32e-53	209	4599	0.079	0.030	A0A2R8RIJ1_DANRE Plectin a OS=Danio rerio OX=7955 GN=fa95h11 PE=1 SV=1
12	A0A286YBE9	4.59e-53	209	4773	0.079	0.029	A0A286YBE9_DANRE Plectin a OS=Danio rerio OX=7955 GN=fa95h11 PE=1 SV=1
13	A5WV02	4.74e-53	209	4577	0.079	0.030	A5WV02_DANRE Plectin OS=Danio rerio OX=7955 GN=fa95h11 PE=1 SV=1
14	E9QCV2	1.41e-51	204	4530	0.072	0.028	E9QCV2_DANRE Plectin b OS=Danio rerio OX=7955 GN=si:ch211-165e15.1 PE=1 SV=1
15	A0A0R4IJ71	1.56e-51	204	4506	0.072	0.028	A0A0R4IJ71_DANRE Plectin b OS=Danio rerio OX=7955 GN=si:ch211-165e15.1 PE=1 SV=2
16	Q15149	6.24e-51	202	4684	0.078	0.029	PLEC_HUMAN Plectin OS=Homo sapiens OX=9606 GN=PLEC PE=1 SV=3
17	P30427	1.62e-50	201	4687	0.075	0.028	PLEC_RAT Plectin OS=Rattus norvegicus OX=10116 GN=Plec PE=1 SV=2
18	Q9QXS1	1.11e-49	198	4691	0.075	0.028	PLEC_MOUSE Plectin OS=Mus musculus OX=10090 GN=Plec PE=1 SV=3
19	H0YDN1	7.04e-49	195	3447	0.077	0.039	H0YDN1_HUMAN Plectin OS=Homo sapiens OX=9606 GN=PLEC PE=1 SV=9
20	Q9JI55	1.18e-46	188	4473	0.073	0.029	PLEC_CRIGR Plectin (Fragment) OS=Cricetulus griseus OX=10029 GN=PLEC PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08614 ATG16	7.7	18.2	Autophagy protein 16 (ATG16)
2	PF00681 Plectin	0.0017	29.5	Plectin repeat
3	PF17902 SH3_10	1.3e-12	58.9	SH3 domain
4	PF00435 Spectrin	23	16.9	Spectrin repeat
5	PF12329 TMF_DNA_bd	2e+02	13.4	TATA element modulatory factor 1 DNA binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000340510

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000301607	0.996	Envoplakin
2	9606.ENSP00000356042	0.968	Ezrin
3	9606.ENSP00000289361	0.961	Butyrophilin subfamily 3 member A1
4	9606.ENSP00000331678	0.960	Plakophilin-3
5	9606.ENSP00000365198	0.957	Kazrin
6	9606.ENSP00000326018	0.945	Periaxin
7	9606.ENSP00000393417	0.928	Caspase-14
8	9606.ENSP00000220420	0.920	Protein-glutamine gamma-glutamyltransferase 5
9	9606.ENSP00000449404	0.905	Keratin, type II cytoskeletal 8
10	9606.ENSP00000357753	0.885	Involucrin
11	9606.ENSP00000358165	0.885	High affinity immunoglobulin gamma Fc receptor I
12	9606.ENSP00000451828	0.857	RAC-alpha serine/threonine-protein kinase
13	9606.ENSP00000257189	0.841	Desmoglein-3
14	9606.ENSP00000356842	0.825	Cell surface A33 antigen
15	9606.ENSP00000357731	0.822	Loricrin
16	9606.ENSP00000378935	0.822	Periphilin-1
17	9606.ENSP00000206765	0.820	Protein-glutamine gamma-glutamyltransferase K
18	9606.ENSP00000299698	0.815	Alpha-2-macroglobulin-like protein 1
19	9606.ENSP00000249016	0.814	Melanin-concentrating hormone receptor 1
20	9606.ENSP00000440847	0.814	Zinc finger protein 185

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.977	structural molecule activity
GO:0050839	0.974	cell adhesion molecule binding
GO:0045296	0.935	cadherin binding
GO:0005200	0.921	structural constituent of cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.953	biological regulation
GO:0050896	0.938	response to stimulus
GO:0050789	0.924	regulation of biological process
GO:0009987	0.794	cellular process
GO:0048583	0.695	regulation of response to stimulus
GO:0009612	0.676	response to mechanical stimulus
GO:0019222	0.596	regulation of metabolic process
GO:0002682	0.575	regulation of immune system process
GO:0002920	0.569	regulation of humoral immune response
GO:0002700	0.569	regulation of production of molecular mediator of immune response
GO:0032101	0.555	regulation of response to external stimulus
GO:0002831	0.552	regulation of response to biotic stimulus
GO:0002786	0.527	regulation of antibacterial peptide production
GO:0050794	0.446	regulation of cellular process
GO:0032502	0.351	developmental process
GO:0071840	0.348	cellular component organization or biogenesis
GO:0048856	0.337	anatomical structure development
GO:0048518	0.335	positive regulation of biological process
GO:0016043	0.325	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0001533	1.000	cornified envelope
GO:0005829	0.987	cytosol
GO:0043226	0.978	organelle
GO:0005576	0.978	extracellular region
GO:0043227	0.971	membrane-bounded organelle
GO:0043232	0.963	intracellular non-membrane-bounded organelle
GO:0070062	0.925	extracellular exosome
GO:0005856	0.868	cytoskeleton
GO:0043231	0.795	intracellular membrane-bounded organelle
GO:0012505	0.318	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]