StarFunc result for job id O60449

User Input

>input (1722 residues)
MRTGWATPRRPAGLLMLLFWFFDLAEPSGRAANDPFTIVHGNTGKCIKPVYGWIVADDCD
ETEDKLWKWVSQHRLFHLHSQKCLGLDITKSVNELRMFSCDSSAMLWWKCEHHSLYGAAR
YRLALKDGHGTAISNASDVWKKGGSEESLCDQPYHEIYTRDGNSYGRPCEFPFLIDGTWH
HDCILDEDHSGPWCATTLNYEYDRKWGICLKPENGCEDNWEKNEQFGSCYQFNTQTALSW
KEAYVSCQNQGADLLSINSAAELTYLKEKEGIAKIFWIGLNQLYSARGWEWSDHKPLNFL
NWDPDRPSAPTIGGSSCARMDAESGLWQSFSCEAQLPYVCRKPLNNTVELTDVWTYSDTR
CDAGWLPNNGFCYLLVNESNSWDKAHAKCKAFSSDLISIHSLADVEVVVTKLHNEDIKEE
VWIGLKNINIPTLFQWSDGTEVTLTYWDENEPNVPYNKTPNCVSYLGELGQWKVQSCEEK
LKYVCKRKGEKLNDASSDKMCPPDEGWKRHGETCYKIYEDEVPFGTNCNLTITSRFEQEY
LNDLMKKYDKSLRKYFWTGLRDVDSCGEYNWATVGGRRRAVTFSNWNFLEPASPGGCVAM
STGKSVGKWEVKDCRSFKALSICKKMSGPLGPEEASPKPDDPCPEGWQSFPASLSCYKVF
HAERIVRKRNWEEAERFCQALGAHLSSFSHVDEIKEFLHFLTDQFSGQHWLWIGLNKRSP
DLQGSWQWSDRTPVSTIIMPNEFQQDYDIRDCAAVKVFHRPWRRGWHFYDDREFIYLRPF
ACDTKLEWVCQIPKGRTPKTPDWYNPDRAGIHGPPLIIEGSEYWFVADLHLNYEEAVLYC
ASNHSFLATITSFVGLKAIKNKIANISGDGQKWWIRISEWPIDDHFTYSRYPWHRFPVTF
GEECLYMSAKTWLIDLGKPTDCSTKLPFICEKYNVSSLEKYSPDSAAKVQCSEQWIPFQN
KCFLKIKPVSLTFSQASDTCHSYGGTLPSVLSQIEQDFITSLLPDMEATLWIGLRWTAYE
KINKWTDNRELTYSNFHPLLVSGRLRIPENFFEEESRYHCALILNLQKSPFTGTWNFTSC
SERHFVSLCQKYSEVKSRQTLQNASETVKYLNNLYKIIPKTLTWHSAKRECLKSNMQLVS
ITDPYQQAFLSVQALLHNSSLWIGLFSQDDELNFGWSDGKRLHFSRWAETNGQLEDCVVL
DTDGFWKTVDCNDNQPGAICYYSGNETEKEVKPVDSVKCPSPVLNTPWIPFQNCCYNFII
TKNRHMATTQDEVHTKCQKLNPKSHILSIRDEKENNFVLEQLLYFNYMASWVMLGITYRN
KSLMWFDKTPLSYTHWRAGRPTIKNEKFLAGLSTDGFWDIQTFKVIEEAVYFHQHSILAC
KIEMVDYKEEYNTTLPQFMPYEDGIYSVIQKKVTWYEALNMCSQSGGHLASVHNQNGQLF
LEDIVKRDGFPLWVGLSSHDGSESSFEWSDGSTFDYIPWKGQTSPGNCVLLDPKGTWKHE
KCNSVKDGAICYKPTKSKKLSRLTYSSRCPAAKENGSRWIQYKGHCYKSDQALHSFSEAK
KLCSKHDHSATIVSIKDEDENKFVSRLMRENNNITMRVWLGLSQHSVDQSWSWLDGSEVT
FVKWENKSKSGVGRCSMLIASNETWKKVECEHGFGRVVCKVPLGPDYTAIAIIVATLSIL
VLMGGLIWFLFQRHRLHLAGFSSVRYAQGVNEDEIMLPSFHD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7jptA	0.435	0.556	0.000	1327	0.770	0.999	7jptA.pdb.gz
2	PDB:7qsrA	0.421	0.534	0.000	1335	0.275	0.355	7qsrA.pdb.gz
3	AFDB:O60449	1.000	1.000	0.000	1722	1.000	1.000	O60449.pdb.gz	LY75_HUMAN Lymphocyte antigen 75 OS=Homo sapiens OX=9606 GN=LY75 PE=1 SV=3
4	AFDB:Q13018	0.467	0.542	0.000	1463	0.284	0.334	Q13018.pdb.gz	PLA2R_HUMAN Secretory phospholipase A2 receptor OS=Homo sapiens OX=9606 GN=PLA2R1 PE=1 SV=2
5	AFDB:Q4TU93	0.394	0.455	0.000	1480	0.269	0.313	Q4TU93.pdb.gz	MRC2_RAT C-type mannose receptor 2 OS=Rattus norvegicus OX=10116 GN=Mrc2 PE=1 SV=1
6	AFDB:Q60767	0.470	0.470	0.000	1723	0.768	0.768	Q60767.pdb.gz	LY75_MOUSE Lymphocyte antigen 75 OS=Mus musculus OX=10090 GN=Ly75 PE=1 SV=2
7	AFDB:Q62028	0.481	0.550	0.000	1487	0.279	0.323	Q62028.pdb.gz	PLA2R_MOUSE Secretory phospholipase A2 receptor OS=Mus musculus OX=10090 GN=Pla2r1 PE=1 SV=1
8	AFDB:P22897	0.422	0.485	6.491E-102	1456	0.228	0.269	P22897.pdb.gz	MRC1_HUMAN Macrophage mannose receptor 1 OS=Homo sapiens OX=9606 GN=MRC1 PE=1 SV=1
9	AFDB:Q61830	0.415	0.479	2.072E-100	1456	0.226	0.268	Q61830.pdb.gz	MRC1_MOUSE Macrophage mannose receptor 1 OS=Mus musculus OX=10090 GN=Mrc1 PE=1 SV=2
10	AFDB:Q17452	0.070	0.370	2.812E-16	308	0.039	0.218	Q17452.pdb.gz	Q17452_CAEEL C-type lectin domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=clec-52 PE=1 SV=1
11	AFDB:Q9XUA7	0.072	0.375	4.478E-16	295	0.035	0.207	Q9XUA7.pdb.gz	Q9XUA7_CAEEL C-type lectin domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=clec-187 PE=1 SV=1
12	AFDB:F8W252	0.079	0.090	1.078E-15	1373	0.128	0.160	F8W252.pdb.gz
13	PDB:5f2qB	0.070	0.828	1.562E-8	135	0.017	0.215	5f2qB.pdb.gz	C-type lectin from Bothrops jararacussu
14	PDB:1qddA	0.073	0.796	1.824E-8	144	0.023	0.278	1qddA.pdb.gz	Mechanism of calcite crystal growth inhibition by the N-terminal undecapeptide of lithostathine.
15	PDB:4mthA	0.067	0.759	3.059E-8	139	0.020	0.245	4mthA.pdb.gz	Antibacterial membrane attack by a pore-forming intestinal C-type lectin.
16	PDB:3bx4C	0.058	0.659	2.973E-7	134	0.023	0.291	3bx4C.pdb.gz
17	PDB:1gz2A	0.070	0.787	3.131E-7	139	0.018	0.223	1gz2A.pdb.gz
18	PDB:7wz8A	0.068	0.603	3.656E-7	180	0.015	0.144	7wz8A.pdb.gz
19	PDB:2kv3A	0.067	0.715	5.822E-7	131	0.019	0.244	2kv3A.pdb.gz
20	PDB:1bj3B	0.059	0.725	1.028E-6	123	0.017	0.236	1bj3B.pdb.gz	Crystal structure of coagulation factor IX-binding protein from habu snake venom at 2.6 A: implication of central loop swapping based on deletion in the linker region.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60449	0.0	3593	1722	1.000	1.000	LY75_HUMAN Lymphocyte antigen 75 OS=Homo sapiens OX=9606 GN=LY75 PE=1 SV=3
2	Q13018	0.0	763	1463	0.282	0.332	PLA2R_HUMAN Secretory phospholipase A2 receptor OS=Homo sapiens OX=9606 GN=PLA2R1 PE=1 SV=2
3	Q4LDF5	0.0	1781	1732	0.515	0.512	Q4LDF5_CHICK DEC-205 protein OS=Gallus gallus OX=9031 GN=DEC205 PE=2 SV=1
4	Q4TU93	0.0	688	1480	0.258	0.301	MRC2_RAT C-type mannose receptor 2 OS=Rattus norvegicus OX=10116 GN=Mrc2 PE=1 SV=1
5	Q60767	0.0	2813	1723	0.769	0.768	LY75_MOUSE Lymphocyte antigen 75 OS=Mus musculus OX=10090 GN=Ly75 PE=1 SV=2
6	Q62028	0.0	747	1487	0.280	0.325	PLA2R_MOUSE Secretory phospholipase A2 receptor OS=Mus musculus OX=10090 GN=Pla2r1 PE=1 SV=1
7	Q64449	0.0	706	1479	0.265	0.309	MRC2_MOUSE C-type mannose receptor 2 OS=Mus musculus OX=10090 GN=Mrc2 PE=1 SV=3
8	Q9UBG0	0.0	705	1479	0.272	0.316	MRC2_HUMAN C-type mannose receptor 2 OS=Homo sapiens OX=9606 GN=MRC2 PE=1 SV=2
9	P22897	4.07e-145	488	1456	0.231	0.273	MRC1_HUMAN Macrophage mannose receptor 1 OS=Homo sapiens OX=9606 GN=MRC1 PE=1 SV=1
10	Q61830	2.00e-141	477	1456	0.233	0.275	MRC1_MOUSE Macrophage mannose receptor 1 OS=Mus musculus OX=10090 GN=Mrc1 PE=1 SV=2
11	Q17452	2.78e-15	80.9	308	0.033	0.185	Q17452_CAEEL C-type lectin domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=clec-52 PE=1 SV=1
12	Q8IX05	1.32e-14	77.4	232	0.031	0.228	CD302_HUMAN CD302 antigen OS=Homo sapiens OX=9606 GN=CD302 PE=1 SV=1
13	Q6ZS10	2.24e-12	73.2	378	0.025	0.114	CL17A_HUMAN C-type lectin domain family 17, member A OS=Homo sapiens OX=9606 GN=CLEC17A PE=1 SV=2
14	E7F537	3.70e-12	74.3	1509	0.023	0.026	E7F537_DANRE Aggrecan a OS=Danio rerio OX=7955 GN=acana PE=4 SV=3
15	F1QDA1	4.26e-12	74.3	1547	0.023	0.025	F1QDA1_DANRE Aggrecan a OS=Danio rerio OX=7955 GN=acana PE=4 SV=2
16	O14594	1.26e-11	72.4	1321	0.026	0.034	NCAN_HUMAN Neurocan core protein OS=Homo sapiens OX=9606 GN=NCAN PE=1 SV=3
17	P55068	1.28e-11	72.4	883	0.024	0.046	PGCB_RAT Brevican core protein OS=Rattus norvegicus OX=10116 GN=Bcan PE=1 SV=2
18	P55066	3.74e-11	70.9	1268	0.026	0.035	NCAN_MOUSE Neurocan core protein OS=Mus musculus OX=10090 GN=Ncan PE=1 SV=1
19	L0N7P8	6.68e-11	66.2	216	0.021	0.167	L0N7P8_ONCMY CD209 antigen-like protein A OS=Oncorhynchus mykiss OX=8022 GN=cd209A PE=2 SV=1
20	P55067	7.58e-11	70.1	1257	0.025	0.034	NCAN_RAT Neurocan core protein OS=Rattus norvegicus OX=10116 GN=Ncan PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05966 Chordopox_A33R	2.7	18.7	Chordopoxvirus A33R protein
2	PF00040 fn2	1.5e-11	55.4	Fibronectin type II domain
3	PF07979 Intimin_C	1.8e+02	14.0	Intimin C-type lectin domain
4	PF00059 Lectin_C	1.1e-134	452.6	Lectin C-type domain
5	PF05473 UL45	1.5e-07	42.8	UL45 protein, carbohydrate-binding C-type lectin-like
6	PF00193 Xlink	2.6e-05	35.8	Extracellular link domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263636

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000454623	0.832	Integrin alpha-X
2	9606.ENSP00000348074	0.806	C-type lectin domain family 9 member A
3	9606.ENSP00000386378	0.804	C-type lectin domain family 4 member K
4	9606.ENSP00000361359	0.773	Tumor necrosis factor receptor superfamily member 5
5	9606.ENSP00000315477	0.772	CD209 antigen
6	9606.ENSP00000332049	0.767	T-lymphocyte activation antigen CD86
7	9606.ENSP00000011653	0.737	T-cell surface glycoprotein CD4
8	9606.ENSP00000264246	0.737	T-lymphocyte activation antigen CD80
9	9606.ENSP00000411355	0.735	Receptor-type tyrosine-protein phosphatase C
10	9606.ENSP00000386559	0.730	T-cell surface glycoprotein CD8 alpha chain
11	9606.ENSP00000441691	0.727	Integrin alpha-M
12	9606.ENSP00000229332	0.724	C-type lectin domain family 4 member A
13	9606.ENSP00000263087	0.700	Integrin alpha-E
14	9606.ENSP00000296871	0.698	Granulocyte-macrophage colony-stimulating factor
15	9606.ENSP00000353874	0.680	Toll-like receptor 9
16	9606.ENSP00000302569	0.669	C-type lectin domain family 7 member A
17	9606.ENSP00000231449	0.668	Interleukin-4
18	9606.ENSP00000469441	0.660	Cancer/testis antigen 1A
19	9606.ENSP00000310405	0.650	Chemokine XC receptor 1
20	9606.ENSP00000357152	0.636	T-cell surface glycoprotein CD1c

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0038023	1.000	signaling receptor activity
GO:0005515	1.000	protein binding
GO:0004888	0.477	transmembrane signaling receptor activity
GO:0019899	0.344	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0002376	0.990	immune system process
GO:0006952	0.960	defense response
GO:0006955	0.930	immune response
GO:0009987	0.914	cellular process
GO:0051716	0.854	cellular response to stimulus
GO:0065007	0.846	biological regulation
GO:0050789	0.797	regulation of biological process
GO:0006954	0.771	inflammatory response
GO:0048518	0.743	positive regulation of biological process
GO:0050794	0.634	regulation of cellular process
GO:0009605	0.498	response to external stimulus
GO:0042221	0.429	response to chemical
GO:0010033	0.415	response to organic substance
GO:0048522	0.358	positive regulation of cellular process
GO:0048583	0.348	regulation of response to stimulus
GO:0044419	0.328	biological process involved in interspecies interaction between organisms

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043227	0.983	membrane-bounded organelle
GO:0005576	0.957	extracellular region
GO:0031982	0.942	vesicle
GO:0005615	0.929	extracellular space
GO:0009986	0.923	cell surface
GO:0070062	0.736	extracellular exosome
GO:0043231	0.702	intracellular membrane-bounded organelle
GO:0005737	0.692	cytoplasm
GO:0032991	0.644	protein-containing complex
GO:0098552	0.301	side of membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]