StarFunc result for job id O60469

User Input

>input (2012 residues)
MWILALSLFQSFANVFSEDLHSSLYFVNASLQEVVFASTTGTLVPCPAAGIPPVTLRWYL
ATGEEIYDVPGIRHVHPNGTLQIFPFPPSSFSTLIHDNTYYCTAENPSGKIRSQDVHIKA
VLREPYTVRVEDQKTMRGNVAVFKCIIPSSVEAYITVVSWEKDTVSLVSGSRFLITSTGA
LYIKDVQNEDGLYNYRCITRHRYTGETRQSNSARLFVSDPANSAPSILDGFDHRKAMAGQ
RVELPCKALGHPEPDYRWLKDNMPLELSGRFQKTVTGLLIENIRPSDSGSYVCEVSNRYG
TAKVIGRLYVKQPLKATISPRKVKSSVGSQVSLSCSVTGTEDQELSWYRNGEILNPGKNV
RITGINHENLIMDHMVKSDGGAYQCFVRKDKLSAQDYVQVVLEDGTPKIISAFSEKVVSP
AEPVSLMCNVKGTPLPTITWTLDDDPILKGGSHRISQMITSEGNVVSYLNISSSQVRDGG
VYRCTANNSAGVVLYQARINVRGPASIRPMKNITAIAGRDTYIHCRVIGYPYYSIKWYKN
SNLLPFNHRQVAFENNGTLKLSDVQKEVDEGEYTCNVLVQPQLSTSQSVHVTVKVPPFIQ
PFEFPRFSIGQRVFIPCVVVSGDLPITITWQKDGRPIPGSLGVTIDNIDFTSSLRISNLS
LMHNGNYTCIARNEAAAVEHQSQLIVRVPPKFVVQPRDQDGIYGKAVILNCSAEGYPVPT
IVWKFSKGAGVPQFQPIALNGRIQVLSNGSLLIKHVVEEDSGYYLCKVSNDVGADVSKSM
YLTVKIPAMITSYPNTTLATQGQKKEMSCTAHGEKPIIVRWEKEDRIINPEMARYLVSTK
EVGEEVISTLQILPTVREDSGFFSCHAINSYGEDRGIIQLTVQEPPDPPEIEIKDVKART
ITLRWTMGFDGNSPITGYDIECKNKSDSWDSAQRTKDVSPQLNSATIIDIHPSSTYSIRM
YAKNRIGKSEPSNELTITADEAAPDGPPQEVHLEPISSQSIRVTWKAPKKHLQNGIIRGY
QIGYREYSTGGNFQFNIISVDTSGDSEVYTLDNLNKFTQYGLVVQACNRAGTGPSSQEII
TTTLEDVPSYPPENVQAIATSPESISISWSTLSKEALNGILQGFRVIYWANLMDGELGEI
KNITTTQPSLELDGLEKYTNYSIQVLAFTRAGDGVRSEQIFTRTKEDVPGPPAGVKAAAA
SASMVFVSWLPPLKLNGIIRKYTVFCSHPYPTVISEFEASPDSFSYRIPNLSRNRQYSVW
VVAVTSAGRGNSSEIITVEPLAKAPARILTFSGTVTTPWMKDIVLPCKAVGDPSPAVKWM
KDSNGTPSLVTIDGRRSIFSNGSFIIRTVKAEDSGYYSCIANNNWGSDEIILNLQVQVPP
DQPRLTVSKTTSSSITLSWLPGDNGGSSIRGYILQYSEDNSEQWGSFPISPSERSYRLEN
LKCGTWYKFTLTAQNGVGPGRISEIIEAKTLGKEPQFSKEQELFASINTTRVRLNLIGWN
DGGCPITSFTLEYRPFGTTVWTTAQRTSLSKSYILYDLQEATWYELQMRVCNSAGCAEKQ
ANFATLNYDGSTIPPLIKSVVQNEEGLTTNEGLKMLVTISCILVGVLLLFVLLLVVRRRR
REQRLKRLRDAKSLAEMLMSKNTRTSDTLSKQQQTLRMHIDIPRAQLLIEERDTMETIDD
RSTVLLTDADFGEAAKQKSLTVTHTVHYQSVSQATGPLVDVSDARPGTNPTTRRNAKAGP
TARNRYASQWTLNRPHPTISAHTLTTDWRLPTPRAAGSVDKESDSYSVSPSQDTDRARSS
MVSTESASSTYEELARAYEHAKMEEQLRHAKFTITECFISDTSSEQLTAGTNEYTDSLTS
STPSESGICRFTASPPKPQDGGRVMNMAVPKAHRPGDLIHLPPYLRMDFLLNRGGPGTSR
DLSLGQACLEPQKSRTLKRPTVLEPIPMEAASSASSTREGQSWQPGAVATLPQREGAELG
QAAKMSSSQESLLDSRGHLKGNNPYAKSYTLV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0B4K6Z6	0.355	0.351	0.000	2037	0.290	0.286	A0A0B4K6Z6.pdb.gz	A0A0B4K6Z6_DROME Down syndrome cell adhesion molecule 1, isoform BQ OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
2	AFDB:A0A2R8QL08	0.384	0.380	0.000	2036	0.782	0.773	A0A2R8QL08.pdb.gz
3	AFDB:F1NY98	0.461	0.457	0.000	2034	0.939	0.929	F1NY98.pdb.gz	DSCAM_CHICK Cell adhesion molecule DSCAM OS=Gallus gallus OX=9031 GN=DSCAM PE=1 SV=3
4	AFDB:Q4VA61	0.467	0.460	0.000	2053	0.606	0.594	Q4VA61.pdb.gz	DSCL1_MOUSE Cell adhesion molecule DSCAML1 OS=Mus musculus OX=10090 GN=Dscaml1 PE=1 SV=2
5	PDB:5oj2B	0.088	0.221	1.871E-29	692	0.074	0.215	5oj2B.pdb.gz
6	PDB:1e07A	0.117	0.283	3.154E-20	642	0.058	0.181	1e07A.pdb.gz
7	PDB:7sqcO0	0.075	0.122	7.999E-17	1140	0.050	0.089	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
8	PDB:5a42A	0.066	0.076	1.240E-15	1597	0.049	0.062	5a42A.pdb.gz
9	PDB:7q1yA	0.068	0.085	4.531E-14	1374	0.062	0.090	7q1yA.pdb.gz
10	PDB:6pxvA	0.125	0.283	1.022E-13	823	0.033	0.080	6pxvA.pdb.gz
11	PDB:7q5zA	0.104	0.138	1.784E-13	1344	0.034	0.051	7q5zA.pdb.gz
12	PDB:8dtlA	0.126	0.313	2.513E-13	741	0.032	0.088	8dtlA.pdb.gz
13	PDB:6dldD	0.076	0.401	2.738E-13	269	0.031	0.234	6dldD.pdb.gz
14	PDB:8eyyA	0.122	0.289	4.386E-13	775	0.036	0.094	8eyyA.pdb.gz
15	AFDB:I2HAJ6	0.050	0.054	1.575E-8	1725	0.102	0.119	I2HAJ6.pdb.gz	I2HAJ6_CAEEL Neurexin-3-beta OS=Caenorhabditis elegans OX=6239 GN=nrx-1 PE=4 SV=1
16	AFDB:E9Q4Y4	0.075	0.063	1.154E-5	2514	0.061	0.049	E9Q4Y4.pdb.gz	E9Q4Y4_MOUSE Centrosomal protein 192 OS=Mus musculus OX=10090 GN=Cep192 PE=1 SV=1
17	AFDB:Q8TEP8	0.077	0.068	3.513E-5	2537	0.069	0.054	Q8TEP8.pdb.gz	CE192_HUMAN Centrosomal protein of 192 kDa OS=Homo sapiens OX=9606 GN=CEP192 PE=1 SV=3
18	AFDB:D3ZEB1	0.042	0.037	7.430E-3	2257	0.066	0.059	D3ZEB1.pdb.gz	D3ZEB1_RAT Coagulation factor VIII OS=Rattus norvegicus OX=10116 GN=F8 PE=3 SV=4
19	AFDB:F1LRR4	0.042	0.048	8.095E-3	1551	0.061	0.079	F1LRR4.pdb.gz	F1LRR4_RAT WD repeat domain 62 OS=Rattus norvegicus OX=10116 GN=Wdr62 PE=1 SV=4
20	AFDB:Q9NRJ4	0.037	0.043	8.449E-3	1543	0.076	0.099	Q9NRJ4.pdb.gz	TULP4_HUMAN Tubby-related protein 4 OS=Homo sapiens OX=9606 GN=TULP4 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4K6Q9	895	2035	0.263	0.260	A0A0B4K6Q9_DROME Down syndrome cell adhesion molecule 1, isoform CA (Fragment) OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
2	A0A0B4K6R4	919	2035	0.264	0.261	A0A0B4K6R4_DROME Down syndrome cell adhesion molecule 1, isoform BK OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
3	A0A0B4K6R8	907	2019	0.263	0.263	A0A0B4K6R8_DROME Down syndrome cell adhesion molecule 1, isoform BP OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
4	A0A0B4K6S2	910	2036	0.265	0.262	A0A0B4K6S2_DROME Down syndrome cell adhesion molecule 1, isoform BV OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
5	A0A0B4K6Y9	898	2020	0.263	0.262	A0A0B4K6Y9_DROME Down syndrome cell adhesion molecule 1, isoform CB (Fragment) OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
6	A0A0B4K6Z3	920	2019	0.266	0.265	A0A0B4K6Z3_DROME Down syndrome cell adhesion molecule 1, isoform BL OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
7	A0A0B4K6Z6	885	2037	0.264	0.261	A0A0B4K6Z6_DROME Down syndrome cell adhesion molecule 1, isoform BQ OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
8	A0A0B4K6Z8	918	2016	0.266	0.265	A0A0B4K6Z8_DROME Down syndrome cell adhesion molecule 1, isoform BW OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
9	A0A0B4K7H7	888	2020	0.261	0.260	A0A0B4K7H7_DROME Down syndrome cell adhesion molecule 1, isoform BY (Fragment) OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
10	A0A0B4K7H9	894	2030	0.260	0.258	A0A0B4K7H9_DROME Down syndrome cell adhesion molecule 1, isoform BI OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
11	A0A0B4K7I3	905	2036	0.265	0.262	A0A0B4K7I3_DROME Down syndrome cell adhesion molecule 1, isoform BN OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
12	A0A0B4K7I5	919	2016	0.266	0.265	A0A0B4K7I5_DROME Down syndrome cell adhesion molecule 1, isoform BT OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
13	A0A0B4K7T4	889	2035	0.261	0.258	A0A0B4K7T4_DROME Down syndrome cell adhesion molecule 1, isoform BZ (Fragment) OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
14	A0A0B4K7T5	897	2033	0.261	0.259	A0A0B4K7T5_DROME Down syndrome cell adhesion molecule 1, isoform BJ OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
15	A0A0B4K7T6	907	2019	0.263	0.263	A0A0B4K7T6_DROME Down syndrome cell adhesion molecule 1, isoform BO OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
16	A0A0B4K7T8	911	2034	0.264	0.262	A0A0B4K7T8_DROME Down syndrome cell adhesion molecule 1, isoform BU OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
17	A0A0B4K823	892	2038	0.261	0.258	A0A0B4K823_DROME Down syndrome cell adhesion molecule 1, isoform BX (Fragment) OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
18	A0A0B4K824	903	2035	0.264	0.261	A0A0B4K824_DROME Down syndrome cell adhesion molecule 1, isoform CC (Fragment) OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
19	A0A0B4K827	910	2028	0.263	0.261	A0A0B4K827_DROME Down syndrome cell adhesion molecule 1, isoform BM OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
20	A0A0B4K828	915	2032	0.266	0.264	A0A0B4K828_DROME Down syndrome cell adhesion molecule 1, isoform BR OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02440 Adeno_E3_CR1	68	14.7	Adenovirus E3 region protein CR1
2	PF07654 C1-set	2.5e-05	35.9	Immunoglobulin C1-set domain
3	PF08205 C2-set_2	3.8e-12	57.4	CD80-like C2-set immunoglobulin domain
4	PF08329 ChitinaseA_N	0.097	23.8	Chitinase A, N-terminal domain
5	PF19904 DUF6377	2e+02	12.9	Domain of unknown function (DUF6377)
6	PF00041 fn3	7.2e-81	278.0	Fibronectin type III domain
7	PF16893 fn3_2	0.005	28.3	Fibronectin type III domain
8	PF07679 I-set	5.5e-114	383.8	Immunoglobulin I-set domain
9	PF00047 ig	1.3e-70	244.9	Immunoglobulin domain
10	PF13895 Ig_2	7.6e-83	284.2	Immunoglobulin domain
11	PF13927 Ig_3	1.2e-110	373.6	Immunoglobulin domain
12	PF16680 Ig_4	4.5e-08	44.9	T-cell surface glycoprotein CD3 delta chain
13	PF16681 Ig_5	4.3e-17	73.6	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
14	PF18452 Ig_6	0.00022	32.5	Immunoglobulin domain
15	PF09294 Interfer-bind	0.00032	32.3	Interferon-alpha/beta receptor, fibronectin type III
16	PF16706 Izumo-Ig	0.069	24.4	Izumo-like Immunoglobulin domain
17	PF16656 Pur_ac_phosph_N	2.4e-06	39.4	Purple acid Phosphatase, N-terminal domain
18	PF11465 Receptor_2B4	0.02	26.4	Natural killer cell receptor 2B4
19	PF07686 V-set	3e-25	99.9	Immunoglobulin V-set domain
20	PF08204 V-set_CD47	17	16.8	CD47 immunoglobulin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000383303

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000173229	0.999	Netrin-1
2	9606.ENSP00000378974	0.944	Mitogen-activated protein kinase 8
3	9606.ENSP00000229795	0.904	Mitogen-activated protein kinase 14
4	9606.ENSP00000333685	0.904	Mitogen-activated protein kinase 11
5	9606.ENSP00000211287	0.902	Mitogen-activated protein kinase 13
6	9606.ENSP00000215659	0.901	Mitogen-activated protein kinase 12
7	9606.ENSP00000389140	0.898	Netrin receptor DCC
8	9606.ENSP00000278568	0.798	Serine/threonine-protein kinase PAK 1
9	9606.ENSP00000347719	0.773	Tubulin-specific chaperone D
10	9606.ENSP00000417273	0.735	Cytoplasmic protein NCK1
11	9606.ENSP00000376024	0.732	Sorting nexin-9
12	9606.ENSP00000332737	0.716	Netrin receptor UNC5A
13	9606.ENSP00000406022	0.709	Netrin receptor UNC5C
14	9606.ENSP00000298355	0.689	E3 ubiquitin-protein ligase TRIM9
15	9606.ENSP00000334329	0.670	Netrin receptor UNC5B
16	9606.ENSP00000471242	0.662	FERM, ARHGEF and pleckstrin domain-containing protein 1
17	9606.ENSP00000348461	0.644	Ras-related C3 botulinum toxin substrate 1
18	9606.ENSP00000340998	0.631	Netrin-4
19	9606.ENSP00000008938	0.598	Peptidoglycan recognition protein 1
20	9606.ENSP00000294485	0.584	Draxin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	0.996	signaling receptor binding
GO:0042802	0.987	identical protein binding
GO:0042803	0.865	protein homodimerization activity
GO:0038023	0.834	signaling receptor activity
GO:0004888	0.806	transmembrane signaling receptor activity
GO:0008046	0.599	axon guidance receptor activity
GO:0003823	0.547	antigen binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0032501	0.968	multicellular organismal process
GO:0050794	0.961	regulation of cellular process
GO:0048856	0.959	anatomical structure development
GO:0007275	0.942	multicellular organism development
GO:0071840	0.915	cellular component organization or biogenesis
GO:0016043	0.913	cellular component organization
GO:0007399	0.855	nervous system development
GO:0048869	0.576	cellular developmental process
GO:0030154	0.574	cell differentiation
GO:0050896	0.563	response to stimulus
GO:0048518	0.494	positive regulation of biological process
GO:0048522	0.469	positive regulation of cellular process
GO:0051128	0.466	regulation of cellular component organization
GO:0009653	0.403	anatomical structure morphogenesis
GO:0048583	0.391	regulation of response to stimulus
GO:0048519	0.338	negative regulation of biological process
GO:0120035	0.317	regulation of plasma membrane bounded cell projection organization
GO:0048513	0.313	animal organ development
GO:0019222	0.313	regulation of metabolic process
GO:0010975	0.308	regulation of neuron projection development
GO:0050793	0.307	regulation of developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0005886	0.993	plasma membrane
GO:0005622	0.775	intracellular anatomical structure
GO:0043227	0.716	membrane-bounded organelle
GO:0005737	0.710	cytoplasm
GO:0005576	0.655	extracellular region
GO:0030054	0.654	cell junction
GO:0043229	0.631	intracellular organelle
GO:0043231	0.607	intracellular membrane-bounded organelle
GO:0045202	0.475	synapse
GO:0120025	0.376	plasma membrane bounded cell projection
GO:0043005	0.354	neuron projection
GO:0005615	0.339	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]