StarFunc result for job id O60476

User Input

>input (641 residues)
MTTPALLPLSGRRIPPLNLGPPSFPHHRATLRLSEKFILLLILSAFITLCFGAFFFLPDS
SKHKRFDLGLEDVLIPHVDAGKGAKNPGVFLIHGPDEHRHREEEERLRNKIRADHEKALE
EAKEKLRKSREEIRAEIQTEKNKVVQEMKIKENKPLPPVPIPNLVGIRGGDPEDNDIREK
REKIKEMMKHAWDNYRTYGWGHNELRPIARKGHSPNIFGSSQMGATIVDALDTLYIMGLH
DEFLDGQRWIEDNLDFSVNSEVSVFEVNIRFIGGLLAAYYLSGEEIFKIKAVQLAEKLLP
AFNTPTGIPWAMVNLKSGVGRNWGWASAGSSILAEFGTLHMEFIHLSYLTGDLTYYKKVM
HIRKLLQKMDRPNGLYPNYLNPRTGRWGQYHTSVGGLGDSFYEYLLKAWLMSDKTDHEAR
KMYDDAIEAIEKHLIKKSRGGLTFIGEWKNGHLEKKMGHLACFAGGMFALGADGSRADKA
GHYLELGAEIARTCHESYDRTALKLGPESFKFDGAVEAVAVRQAEKYYILRPEVIETYWY
LWRFTHDPRYRQWGWEAALAIEKYCRVNGGFSGVKDVYSSTPTHDDVQQSFFLAETLKYL
YLLFSGDDLLPLDHWVFNTEAHPLPVLHLANTTLSGNPAVR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60476	1.000	1.000	0.000	641	1.000	1.000	O60476.pdb.gz	MA1A2_HUMAN Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Homo sapiens OX=9606 GN=MAN1A2 PE=1 SV=1
2	AFDB:P45700	0.750	0.735	7.465E-69	655	0.626	0.612	P45700.pdb.gz	MA1A1_MOUSE Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA OS=Mus musculus OX=10090 GN=Man1a1 PE=1 SV=1
3	AFDB:P53624	0.716	0.688	4.286E-60	667	0.463	0.445	P53624.pdb.gz	MA1A1_DROME Mannosyl-oligosaccharide alpha-1,2-mannosidase IA OS=Drosophila melanogaster OX=7227 GN=alpha-Man-Ia PE=2 SV=2
4	AFDB:Q9NR34	0.692	0.704	5.767E-59	630	0.504	0.513	Q9NR34.pdb.gz	MA1C1_HUMAN Mannosyl-oligosaccharide 1,2-alpha-mannosidase IC OS=Homo sapiens OX=9606 GN=MAN1C1 PE=1 SV=1
5	AFDB:O18498	0.729	0.698	1.349E-54	670	0.431	0.412	O18498.pdb.gz	MA1A1_SPOFR Mannosyl-oligosaccharide alpha-1,2-mannosidase IA OS=Spodoptera frugiperda OX=7108 PE=1 SV=1
6	AFDB:Q9C512	0.693	0.791	3.079E-47	560	0.346	0.396	Q9C512.pdb.gz	MNS1_ARATH Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS1 OS=Arabidopsis thaliana OX=3702 GN=MNS1 PE=1 SV=1
7	AFDB:Q8H116	0.684	0.765	8.595E-45	572	0.346	0.388	Q8H116.pdb.gz	MNS2_ARATH Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS2 OS=Arabidopsis thaliana OX=3702 GN=MNS2 PE=1 SV=1
8	AFDB:A2AJ15	0.677	0.660	4.939E-42	658	0.323	0.315	A2AJ15.pdb.gz	MA1B1_MOUSE Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Mus musculus OX=10090 GN=Man1b1 PE=1 SV=1
9	AFDB:Q9UKM7	0.676	0.620	5.752E-41	699	0.312	0.286	Q9UKM7.pdb.gz	MA1B1_HUMAN Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN1B1 PE=1 SV=2
10	AFDB:A0A1D8PD38	0.675	0.703	3.789E-39	615	0.292	0.304	A0A1D8PD38.pdb.gz	A0A1D8PD38_CANAL alpha-1,2-Mannosidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNS1 PE=3 SV=1
11	PDB:1dl2A	0.655	0.819	3.071E-35	510	0.276	0.347	1dl2A.pdb.gz
12	PDB:1fp3A	0.409	0.609	4.494E-5	402	0.069	0.109	1fp3A.pdb.gz
13	PDB:2rgkA	0.378	0.542	4.494E-5	409	0.072	0.112	2rgkA.pdb.gz
14	PDB:3aniA	0.285	0.434	2.937E-4	378	0.076	0.130	3aniA.pdb.gz
15	PDB:6wq1A	0.358	0.531	1.245E-3	396	0.105	0.169	6wq1A.pdb.gz	LanCLs add glutathione to dehydroamino acids generated at phosphorylated sites in the proteome.
16	PDB:3qxqA	0.288	0.497	1.438E-3	338	0.064	0.121	3qxqA.pdb.gz	Apo- and cellopentaose-bound structures of the bacterial cellulose synthase subunit BcsZ.
17	PDB:5gw7B	0.204	0.182	9.862E-3	760	0.083	0.070	5gw7B.pdb.gz	Crystal structure of the enzyme-product complex reveals sugar ring distortion during catalysis by family 63 inverting alpha-glycosidase
18	PDB:3vxdC	0.261	0.419	1.844E-2	359	0.066	0.117	3vxdC.pdb.gz
19	PDB:3e6uA	0.356	0.509	2.710E-2	409	0.089	0.139	3e6uA.pdb.gz	Structure of human lanthionine synthetase C-like protein 1 and its interaction with Eps8 and glutathione
20	PDB:5hssA	0.263	0.415	3.796E-2	366	0.061	0.107	5hssA.pdb.gz	X-ray structure of linalool dehydratase/isomerase from Castellaniella defragrans reveals enzymatic alkene synthesis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O18498	0.0	543	670	0.438	0.419	MA1A1_SPOFR Mannosyl-oligosaccharide alpha-1,2-mannosidase IA OS=Spodoptera frugiperda OX=7108 PE=1 SV=1
2	O60476	0.0	1324	641	1.000	1.000	MA1A2_HUMAN Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Homo sapiens OX=9606 GN=MAN1A2 PE=1 SV=1
3	P33908	0.0	793	653	0.608	0.597	MA1A1_HUMAN Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA OS=Homo sapiens OX=9606 GN=MAN1A1 PE=1 SV=3
4	P39098	0.0	1243	641	0.945	0.945	MA1A2_MOUSE Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Mus musculus OX=10090 GN=Man1a2 PE=1 SV=1
5	P45700	0.0	798	655	0.622	0.609	MA1A1_MOUSE Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA OS=Mus musculus OX=10090 GN=Man1a1 PE=1 SV=1
6	P53624	0.0	591	667	0.421	0.405	MA1A1_DROME Mannosyl-oligosaccharide alpha-1,2-mannosidase IA OS=Drosophila melanogaster OX=7227 GN=alpha-Man-Ia PE=2 SV=2
7	Q9NR34	0.0	624	630	0.498	0.506	MA1C1_HUMAN Mannosyl-oligosaccharide 1,2-alpha-mannosidase IC OS=Homo sapiens OX=9606 GN=MAN1C1 PE=1 SV=1
8	Q9C512	6.03e-129	393	560	0.321	0.368	MNS1_ARATH Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS1 OS=Arabidopsis thaliana OX=3702 GN=MNS1 PE=1 SV=1
9	Q8H116	3.65e-123	378	572	0.340	0.381	MNS2_ARATH Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS2 OS=Arabidopsis thaliana OX=3702 GN=MNS2 PE=1 SV=1
10	A2AJ15	3.60e-104	332	658	0.284	0.277	MA1B1_MOUSE Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Mus musculus OX=10090 GN=Man1b1 PE=1 SV=1
11	Q9UKM7	1.09e-100	324	699	0.296	0.272	MA1B1_HUMAN Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN1B1 PE=1 SV=2
12	A0A1D8PD38	1.28e-96	311	615	0.279	0.291	A0A1D8PD38_CANAL alpha-1,2-Mannosidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNS1 PE=3 SV=1
13	Q9VAP8	4.05e-93	303	685	0.264	0.247	Q9VAP8_DROME alpha-1,2-Mannosidase OS=Drosophila melanogaster OX=7227 GN=alpha-Man-Ib PE=1 SV=1
14	Q93Y37	8.68e-93	301	624	0.285	0.293	MNS3_ARATH Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3 OS=Arabidopsis thaliana OX=3702 GN=MNS3 PE=1 SV=1
15	A2RBC3	3.29e-87	286	603	0.276	0.294	A2RBC3_ASPNC alpha-1,2-Mannosidase OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=An18g06220 PE=3 SV=1
16	Q9P7C3	1.31e-81	268	521	0.267	0.328	MNS1_SCHPO Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC2E1P5.01c PE=1 SV=2
17	P32906	2.46e-80	266	549	0.278	0.324	MNS1_YEAST Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNS1 PE=1 SV=1
18	Q2UMC2	1.40e-77	263	711	0.267	0.241	Q2UMC2_ASPOR alpha-1,2-Mannosidase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090003000057 PE=3 SV=1
19	Q9SXC9	1.10e-67	233	574	0.261	0.291	MNS5_ARATH Alpha-mannosidase I MNS5 OS=Arabidopsis thaliana OX=3702 GN=MNS5 PE=1 SV=1
20	Q57W82	2.06e-57	206	588	0.259	0.282	Q57W82_TRYB2 alpha-1,2-Mannosidase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.28F14.300 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01532 Glyco_hydro_47	7.3e-150	511.5	Glycosyl hydrolase family 47
2	PF19995 iSTAND	3.5e+02	12.9	inactive STAND

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000348959

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261483	0.974	Alpha-mannosidase 2
2	9606.ENSP00000452948	0.962	Alpha-mannosidase 2x
3	9606.ENSP00000404718	0.960	Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
4	9606.ENSP00000351669	0.923	Glycoprotein endo-alpha-1,2-mannosidase
5	9606.ENSP00000360645	0.918	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase
6	9606.ENSP00000417354	0.909	Golgi integral membrane protein 4
7	9606.ENSP00000357453	0.906	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA
8	9606.ENSP00000363452	0.905	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IC
9	9606.ENSP00000306496	0.900	Ras-related protein Rab-33B
10	9606.ENSP00000324628	0.708	Gamma-soluble NSF attachment protein
11	9606.ENSP00000368540	0.708	Ubiquitin associated protein 2
12	9606.ENSP00000355629	0.700	Conserved oligomeric Golgi complex subunit 2
13	9606.ENSP00000353401	0.686	Homeobox protein cut-like 1
14	9606.ENSP00000305442	0.684	Conserved oligomeric Golgi complex subunit 7
15	9606.ENSP00000358363	0.676	Myomegalin
16	9606.ENSP00000315775	0.668	Conserved oligomeric Golgi complex subunit 4
17	9606.ENSP00000381293	0.663	Vesicle-fusing ATPase
18	9606.ENSP00000297135	0.662	Conserved oligomeric Golgi complex subunit 5
19	9606.ENSP00000225724	0.654	Golgi SNAP receptor complex member 1
20	9606.ENSP00000321997	0.651	La-related protein 1B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004571	1.000	mannosyl-oligosaccharide 1,2-alpha-mannosidase activity
GO:0005488	0.841	binding
GO:0005515	0.431	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044260	0.996	cellular macromolecule metabolic process
GO:0044238	0.995	primary metabolic process
GO:1901564	0.995	organonitrogen compound metabolic process
GO:0019538	0.993	protein metabolic process
GO:0043412	0.975	macromolecule modification
GO:0036211	0.951	protein modification process
GO:1901135	0.871	carbohydrate derivative metabolic process
GO:0006491	0.827	N-glycan processing
GO:0006517	0.498	protein deglycosylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	0.999	Golgi membrane
GO:0005576	0.917	extracellular region
GO:0031982	0.846	vesicle
GO:0070062	0.836	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.2.1.113	1.000	mannosyl-oligosaccharide 1,2-alpha-mannosidase.

[back to server]