StarFunc result for job id O60478

User Input

>input (399 residues)
MRPERPRPRGSAPGPMETPPWDPARNDSLPPTLTPAVPPYVKLGLTVVYTVFYALLFVFI
YVQLWLVLRYRHKRLSYQSVFLFLCLFWASLRTVLFSFYFKDFVAANSLSPFVFWLLYCF
PVCLQFFTLTLMNLYFTQVIFKAKSKYSPELLKYRLPLYLASLFISLVFLLVNLTCAVLV
KTGNWERKVIVSVRVAINDTLFVLCAVSLSICLYKISKMSLANIYLESKGSSVCQVTAIG
VTVILLYTSRACYNLFILSFSQNKSVHSFDYDWYNVSDQADLKNQLGDAGYVLFGVVLFV
WELLPTTLVVYFFRVRNPTKDLTNPGMVPSHGFSPRSYFFDNPRRYDSDDDLAWNIAPQG
LQGGFAPDYYDWGQQTNSFLAQAGTLQDSTLDPDKPSLG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60478	1.000	1.000	4.591E-49	399	1.000	1.000	O60478.pdb.gz	G137B_HUMAN Integral membrane protein GPR137B OS=Homo sapiens OX=9606 GN=GPR137B PE=1 SV=1
2	AFDB:E7F594	0.783	0.836	6.238E-34	373	0.667	0.713	E7F594.pdb.gz	G137B_DANRE G protein-coupled receptor 137Ba OS=Danio rerio OX=7955 GN=gpr137ba PE=3 SV=1
3	AFDB:Q96N19	0.710	0.681	2.801E-22	417	0.476	0.456	Q96N19.pdb.gz	G137A_HUMAN Integral membrane protein GPR137 OS=Homo sapiens OX=9606 GN=GPR137 PE=2 SV=2
4	AFDB:Q17QQ5	0.682	0.689	2.835E-21	395	0.476	0.481	Q17QQ5.pdb.gz	G137A_BOVIN Integral membrane protein GPR137 OS=Bos taurus OX=9913 GN=GPR137 PE=2 SV=2
5	AFDB:Q8N3F9	0.664	0.619	2.036E-20	429	0.449	0.417	Q8N3F9.pdb.gz	G137C_HUMAN Integral membrane protein GPR137C OS=Homo sapiens OX=9606 GN=GPR137C PE=2 SV=2
6	AFDB:D6VTK4	0.310	0.293	6.320E-4	431	0.125	0.116	D6VTK4.pdb.gz	STE2_YEAST Pheromone alpha factor receptor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=STE2 PE=1 SV=2
7	AFDB:A0A2R8QM07	0.345	0.121	1.694E-3	1540	0.123	0.032	A0A2R8QM07.pdb.gz	A0A2R8QM07_DANRE Adhesion G protein-coupled receptor L3 isoform X1 OS=Danio rerio OX=7955 GN=adgrl3.1 PE=4 SV=1
8	AFDB:Q9VFW6	0.348	0.257	2.010E-3	599	0.118	0.078	Q9VFW6.pdb.gz	Q9VFW6_DROME Pyrokinin 2 receptor 2, isoform A OS=Drosophila melanogaster OX=7227 GN=PK2-R2 PE=3 SV=2
9	AFDB:Q868T3	0.405	0.342	3.086E-3	495	0.135	0.109	Q868T3.pdb.gz	CCAPR_DROME Cardioacceleratory peptide receptor OS=Drosophila melanogaster OX=7227 GN=CCAP-R PE=2 SV=4
10	AFDB:Q8IZP9	0.354	0.169	3.362E-3	1017	0.110	0.043	Q8IZP9.pdb.gz	AGRG2_HUMAN Adhesion G-protein coupled receptor G2 OS=Homo sapiens OX=9606 GN=ADGRG2 PE=1 SV=2
11	PDB:7vv6R	0.346	0.461	1.452E-2	271	0.125	0.185	7vv6R.pdb.gz	Structure, function and pharmacology of human itch receptor complexes.
12	PDB:7wvuR	0.312	0.382	3.278E-2	298	0.110	0.148	7wvuR.pdb.gz	Structural basis of FPR2 in recognition of A beta 42 and neuroprotection by humanin.
13	PDB:8dwcR	0.386	0.558	3.422E-2	250	0.105	0.168	8dwcR.pdb.gz	Ligand recognition and allosteric modulation of the human MRGPRX1 receptor.
14	PDB:7wv9R	0.353	0.448	3.572E-2	290	0.095	0.131	7wv9R.pdb.gz	Molecular mechanism of allosteric modulation for the cannabinoid receptor CB1.
15	PDB:7d3sR	0.335	0.445	5.974E-2	266	0.098	0.147	7d3sR.pdb.gz	Structure of the human secretin receptor coupled to an engineered heterotrimeric G protein.
16	PDB:7jhjR	0.396	0.530	6.235E-2	277	0.088	0.126	7jhjR.pdb.gz	Structural basis for the constitutive activity and immunomodulatory properties of the Epstein-Barr virus-encoded G protein-coupled receptor BILF1.
17	PDB:7vugR	0.347	0.446	7.725E-2	282	0.108	0.152	7vugR.pdb.gz	Molecular insights into ligand recognition and G protein coupling of the neuromodulatory orphan receptor GPR139.
18	PDB:7f1qR	0.365	0.389	8.785E-2	367	0.128	0.139	7f1qR.pdb.gz
19	PDB:7ezmD	0.315	0.376	9.170E-2	304	0.115	0.151	7ezmD.pdb.gz	Ligand recognition and G-protein coupling selectivity of cholecystokinin A receptor
20	PDB:7qa8B	0.285	0.351	9.572E-2	299	0.100	0.134	7qa8B.pdb.gz	Activation mechanism of the class D fungal GPCR dimer Ste2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60478	0.0	809	399	1.000	1.000	G137B_HUMAN Integral membrane protein GPR137B OS=Homo sapiens OX=9606 GN=GPR137B PE=1 SV=1
2	Q8BNQ3	0.0	735	385	0.912	0.945	G137B_MOUSE Integral membrane protein GPR137B OS=Mus musculus OX=10090 GN=Gpr137b PE=1 SV=2
3	E7F594	3.56e-180	507	373	0.674	0.721	G137B_DANRE G protein-coupled receptor 137Ba OS=Danio rerio OX=7955 GN=gpr137ba PE=3 SV=1
4	Q17QQ5	8.44e-116	345	395	0.459	0.463	G137A_BOVIN Integral membrane protein GPR137 OS=Bos taurus OX=9913 GN=GPR137 PE=2 SV=2
5	Q96N19	1.14e-114	342	417	0.459	0.439	G137A_HUMAN Integral membrane protein GPR137 OS=Homo sapiens OX=9606 GN=GPR137 PE=2 SV=2
6	Q8N3F9	2.18e-93	288	429	0.411	0.382	G137C_HUMAN Integral membrane protein GPR137C OS=Homo sapiens OX=9606 GN=GPR137C PE=2 SV=2
7	F1QYD4	0.34	35.4	358	0.113	0.126	F1QYD4_DANRE C-C chemokine receptor type 5-like OS=Danio rerio OX=7955 GN=si:ch211-207g17.3 PE=3 SV=3
8	Q6IEE7	0.34	35.8	1074	0.068	0.025	T132E_HUMAN Transmembrane protein 132E OS=Homo sapiens OX=9606 GN=TMEM132E PE=1 SV=2
9	P21129	1.3	33.5	473	0.065	0.055	P3_MOUSE P3 protein OS=Mus musculus OX=10090 GN=Slc10a3 PE=2 SV=2
10	H3BR06	1.8	32.7	283	0.033	0.046	H3BR06_HUMAN Telomeric repeat binding factor 2 (Fragment) OS=Homo sapiens OX=9606 GN=TERF2 PE=1 SV=1
11	J3KSZ6	2.3	31.6	144	0.040	0.111	J3KSZ6_HUMAN Telomeric repeat binding factor 2 (Fragment) OS=Homo sapiens OX=9606 GN=TERF2 PE=1 SV=1
12	O04508	3.4	32.3	383	0.065	0.068	PUP16_ARATH Probable purine permease 16 OS=Arabidopsis thaliana OX=3702 GN=PUP16 PE=2 SV=1
13	Q15554	4.4	32.0	542	0.040	0.030	TERF2_HUMAN Telomeric repeat-binding factor 2 OS=Homo sapiens OX=9606 GN=TERF2 PE=1 SV=3
14	Q9Y535	6.1	30.8	204	0.048	0.093	RPC8_HUMAN DNA-directed RNA polymerase III subunit RPC8 OS=Homo sapiens OX=9606 GN=POLR3H PE=1 SV=1
15	O35548	7.1	31.2	607	0.088	0.058	MMP16_RAT Matrix metalloproteinase-16 OS=Rattus norvegicus OX=10116 GN=Mmp16 PE=2 SV=1
16	G3V8Q4	7.6	31.6	1234	0.048	0.015	G3V8Q4_RAT Retinol binding protein 3 OS=Rattus norvegicus OX=10116 GN=Rbp3 PE=4 SV=1
17	Q9I0Z0	8.6	30.8	347	0.068	0.078	Q9I0Z0_PSEAE Transcriptional regulator MexT OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=mexT PE=1 SV=1
18	U3KQ35	8.6	30.8	244	0.040	0.066	U3KQ35_HUMAN Telomeric repeat binding factor 2 (Fragment) OS=Homo sapiens OX=9606 GN=TERF2 PE=1 SV=1
19	P51512	8.8	31.2	607	0.088	0.058	MMP16_HUMAN Matrix metalloproteinase-16 OS=Homo sapiens OX=9606 GN=MMP16 PE=1 SV=2
20	Q8IHM5	9.4	30.8	314	0.035	0.045	Q8IHM5_PLAF7 Rifin OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1149800 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355551

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000413029	0.734	UPF0415 protein C7orf25
2	9606.ENSP00000361483	0.606	Protein GPR107
3	9606.ENSP00000264080	0.571	G protein-coupled receptor 108
4	9606.ENSP00000386807	0.566	Neuropeptide-like protein C4orf48
5	9606.ENSP00000295049	0.539	Raftlin-2
6	9606.ENSP00000215917	0.532	SRR1-like protein
7	9606.ENSP00000356057	0.515	Transmembrane protein 181
8	9606.ENSP00000376335	0.511	Integral membrane protein GPR155
9	9606.ENSP00000342981	0.508	Adhesion G-protein coupled receptor G5
10	9606.ENSP00000471932	0.508	Transmembrane protein 185A
11	9606.ENSP00000267339	0.504	Ankyrin repeat domain-containing protein 10
12	9606.ENSP00000282841	0.501	Geranylgeranyl pyrophosphate synthase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0002682	0.869	regulation of immune system process
GO:0009894	0.865	regulation of catabolic process
GO:0010506	0.862	regulation of autophagy
GO:0051239	0.841	regulation of multicellular organismal process
GO:0050793	0.829	regulation of developmental process
GO:0065009	0.799	regulation of molecular function
GO:0048519	0.774	negative regulation of biological process
GO:0048522	0.759	positive regulation of cellular process
GO:0002683	0.694	negative regulation of immune system process
GO:0045637	0.685	regulation of myeloid cell differentiation
GO:0002761	0.681	regulation of myeloid leukocyte differentiation
GO:0002762	0.668	negative regulation of myeloid leukocyte differentiation
GO:0045670	0.664	regulation of osteoclast differentiation
GO:0043087	0.643	regulation of GTPase activity
GO:0048583	0.633	regulation of response to stimulus
GO:0034103	0.630	regulation of tissue remodeling
GO:0009966	0.618	regulation of signal transduction
GO:0009987	0.613	cellular process
GO:0002694	0.611	regulation of leukocyte activation
GO:0048584	0.587	positive regulation of response to stimulus
GO:0046850	0.576	regulation of bone remodeling
GO:0032006	0.561	regulation of TOR signaling
GO:0045124	0.555	regulation of bone resorption
GO:0032008	0.527	positive regulation of TOR signaling
GO:1903432	0.450	regulation of TORC1 signaling
GO:0032879	0.389	regulation of localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005765	1.000	lysosomal membrane
GO:0005886	0.991	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]