StarFunc result for job id O60479

User Input

>input (287 residues)
MSGSFDRKLSSILTDISSSLSCHAGSKDSPTLPESSVTDLGYYSAPQHDYYSGQPYGQTV
NPYTYHHQFNLNGLAGTGAYSPKSEYTYGASYRQYGAYREQPLPAQDPVSVKEEPEAEVR
MVNGKPKKVRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNR
RSKFKKLYKNGEVPLEHSPNNSDSMACNSPPSPALWDTSSHSTPAPARSQLPPPLPYSAS
PSYLDDPTNSWYHAQNLSGPHLQQQPPQPATLHHASPGPPPNPGAVY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60479	0.999	0.999	2.077E-41	287	1.000	1.000	O60479.pdb.gz	DLX3_HUMAN Homeobox protein DLX-3 OS=Homo sapiens OX=9606 GN=DLX3 PE=1 SV=1
2	AFDB:Q01702	0.305	0.325	5.660E-25	269	0.662	0.706	Q01702.pdb.gz	DLX3B_DANRE Homeobox protein Dlx3b OS=Danio rerio OX=7955 GN=dlx3b PE=2 SV=1
3	AFDB:P50575	0.319	0.317	1.630E-19	289	0.516	0.512	P50575.pdb.gz	DLX5_RAT Homeobox protein DLX-5 OS=Rattus norvegicus OX=10116 GN=Dlx5 PE=2 SV=1
4	AFDB:P50576	0.306	0.310	5.594E-18	283	0.467	0.473	P50576.pdb.gz	DLX5A_DANRE Homeobox protein Dlx5a OS=Danio rerio OX=7955 GN=dlx5a PE=2 SV=1
5	AFDB:Q98877	0.280	0.323	8.281E-12	247	0.324	0.377	Q98877.pdb.gz	DLX6A_DANRE Homeobox protein Dlx6a OS=Danio rerio OX=7955 GN=dlx6a PE=2 SV=1
6	AFDB:P56177	0.297	0.331	1.008E-11	255	0.334	0.376	P56177.pdb.gz	DLX1_HUMAN Homeobox protein DLX-1 OS=Homo sapiens OX=9606 GN=DLX1 PE=1 SV=3
7	AFDB:Q98875	0.295	0.334	5.179E-11	252	0.348	0.397	Q98875.pdb.gz	DLX1A_DANRE Homeobox protein Dlx1a OS=Danio rerio OX=7955 GN=dlx1a PE=2 SV=1
8	AFDB:Q98878	0.246	0.276	1.383E-10	254	0.334	0.378	Q98878.pdb.gz	DLX4B_DANRE Homeobox protein Dlx4b OS=Danio rerio OX=7955 GN=dlx4b PE=2 SV=2
9	AFDB:P20009	0.298	0.268	5.123E-10	327	0.362	0.318	P20009.pdb.gz	DLL_DROME Homeotic protein distal-less OS=Drosophila melanogaster OX=7227 GN=Dll PE=2 SV=3
10	AFDB:Q58A08	0.231	0.194	5.775E-9	344	0.240	0.201	Q58A08.pdb.gz	Q58A08_ONCMY NK2 homeobox 1b OS=Oncorhynchus mykiss OX=8022 GN=Nkx2-4b PE=2 SV=1
11	PDB:4egcA	0.177	0.094	6.562E-3	539	0.059	0.032	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.164	0.560	1.997E-2	73	0.052	0.205	2hi3A.pdb.gz
13	PDB:7fbyA	0.112	0.192	1.623E-1	153	0.035	0.065	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
14	PDB:5nr5A	0.149	0.339	3.561E-1	113	0.080	0.204	5nr5A.pdb.gz
15	PDB:2cg4A	0.127	0.220	4.059E-1	149	0.031	0.060	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
16	PDB:5z56L	0.154	0.131	4.940E-1	342	0.052	0.044	5z56L.pdb.gz	Structure of the human activated spliceosome in three conformational states.
17	PDB:2cjjA	0.172	0.649	1.157	63	0.045	0.206	2cjjA.pdb.gz
18	PDB:6dv9F	0.148	0.229	1.605	174	0.045	0.075	6dv9F.pdb.gz	Structural basis of ECF-sigma-factor-dependent transcription initiation.
19	PDB:7ml4M	0.125	0.150	1.714	234	0.035	0.043	7ml4M.pdb.gz	Structural visualization of de novo transcription initiation by Saccharomyces cerevisiae RNA polymerase II.
20	PDB:2vbwA	0.102	0.171	1.830	147	0.045	0.088	2vbwA.pdb.gz	Mechanistic Insights from the Crystal Structures of a Feast/Famine Regulatory Protein from Mycobacterium Tuberculosis H37Rv.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60479	0.0	583	287	1.000	1.000	DLX3_HUMAN Homeobox protein DLX-3 OS=Homo sapiens OX=9606 GN=DLX3 PE=1 SV=1
2	Q64205	0.0	573	287	0.979	0.979	DLX3_MOUSE Homeobox protein DLX-3 OS=Mus musculus OX=10090 GN=Dlx3 PE=1 SV=1
3	Q01702	1.60e-118	342	269	0.669	0.714	DLX3B_DANRE Homeobox protein Dlx3b OS=Danio rerio OX=7955 GN=dlx3b PE=2 SV=1
4	P56178	9.76e-79	242	289	0.530	0.526	DLX5_HUMAN Homeobox protein DLX-5 OS=Homo sapiens OX=9606 GN=DLX5 PE=1 SV=2
5	P50575	2.80e-76	236	289	0.526	0.522	DLX5_RAT Homeobox protein DLX-5 OS=Rattus norvegicus OX=10116 GN=Dlx5 PE=2 SV=1
6	P70396	3.72e-76	235	289	0.526	0.522	DLX5_MOUSE Homeobox protein DLX-5 OS=Mus musculus OX=10090 GN=Dlx5 PE=1 SV=1
7	P50576	2.42e-72	226	283	0.474	0.481	DLX5A_DANRE Homeobox protein Dlx5a OS=Danio rerio OX=7955 GN=dlx5a PE=2 SV=1
8	P50574	3.76e-61	196	270	0.481	0.511	DLX2A_DANRE Homeobox protein Dlx2a OS=Danio rerio OX=7955 GN=dlx2a PE=2 SV=1
9	P40764	9.42e-59	192	332	0.390	0.337	DLX2_MOUSE Homeobox protein DLX-2 OS=Mus musculus OX=10090 GN=Dlx2 PE=1 SV=1
10	Q07687	3.28e-58	191	328	0.394	0.345	DLX2_HUMAN Homeobox protein DLX-2 OS=Homo sapiens OX=9606 GN=DLX2 PE=1 SV=2
11	P56177	5.31e-38	136	255	0.244	0.275	DLX1_HUMAN Homeobox protein DLX-1 OS=Homo sapiens OX=9606 GN=DLX1 PE=1 SV=3
12	X5D2F9	5.31e-38	136	255	0.244	0.275	X5D2F9_HUMAN Distal-less homeobox 1 isoform A (Fragment) OS=Homo sapiens OX=9606 GN=DLX1 PE=2 SV=1
13	Q64317	5.43e-38	136	255	0.244	0.275	DLX1_MOUSE Homeobox protein DLX-1 OS=Mus musculus OX=10090 GN=Dlx1 PE=1 SV=1
14	P56179	1.49e-37	132	175	0.240	0.394	DLX6_HUMAN Homeobox protein DLX-6 OS=Homo sapiens OX=9606 GN=DLX6 PE=2 SV=2
15	P70397	4.20e-37	131	175	0.240	0.394	DLX6_MOUSE Homeobox protein DLX-6 OS=Mus musculus OX=10090 GN=Dlx6 PE=2 SV=3
16	Q98875	8.24e-37	133	252	0.286	0.325	DLX1A_DANRE Homeobox protein Dlx1a OS=Danio rerio OX=7955 GN=dlx1a PE=2 SV=1
17	Q98877	9.59e-36	130	247	0.251	0.291	DLX6A_DANRE Homeobox protein Dlx6a OS=Danio rerio OX=7955 GN=dlx6a PE=2 SV=1
18	F8VXJ2	3.33e-33	122	187	0.206	0.316	F8VXJ2_HUMAN Distal-less homeobox 1 (Fragment) OS=Homo sapiens OX=9606 GN=DLX1 PE=1 SV=1
19	Q98878	4.38e-33	123	254	0.220	0.248	DLX4B_DANRE Homeobox protein Dlx4b OS=Danio rerio OX=7955 GN=dlx4b PE=2 SV=2
20	P20009	9.94e-33	124	327	0.216	0.190	DLL_DROME Homeotic protein distal-less OS=Drosophila melanogaster OX=7227 GN=Dll PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12413 DLL_N	5e-22	90.3	Homeobox protein distal-less-like N terminal
2	PF05920 Homeobox_KN	8.6	17.7	Homeobox KN domain
3	PF00046 Homeodomain	1.5e-17	74.5	Homeodomain
4	PF15943 YdaS_antitoxin	4.1e+02	12.4	Putative antitoxin of bacterial toxin-antitoxin system, YdaS/YdaT

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010384419.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010354113.1	0.808	Homeobox protein Meis1-like
2	61622.XP_010365851.1	0.775	Meis homeobox 2
3	61622.XP_010354114.1	0.733	Homeobox protein Meis1 isoform X1
4	61622.XP_010383826.1	0.706	Family with sequence similarity 83 member H
5	61622.XP_010367873.1	0.697	Belongs to the peptidase S1 family.
6	61622.XP_010370838.1	0.675	Forms the heterodimeric complex core-binding factor (CBF) with CBFB. RUNX members modulate the transcription of their target genes through recognizing the core consensus binding sequence 5'- TGTGGT-3', or very rarely, 5'-TGCGGT-3', within their regulatory regions via their runt domain, while CBFB is a non-DNA-binding regulatory subunit that allosterically enhances the sequence-specific DNA-binding capacity of RUNX
7	61622.XP_010361974.1	0.635	SMAD family member 6
8	61622.XP_010356209.1	0.632	Forkhead box protein I2
9	61622.XP_010364338.1	0.583	Paired box protein Pax-8 isoform X1
10	61622.XP_010351172.1	0.581	WD repeat-containing protein 72
11	61622.XP_010360050.1	0.581	WD repeat-containing protein 72-like
12	61622.XP_010373784.1	0.567	SRY-box 3
13	61622.XP_010387523.1	0.566	SRY-box 10
14	61622.XP_010357096.1	0.562	Homeobox protein DLX-4-like
15	61622.XP_010382799.1	0.547	Belongs to the Ca(2+):cation antiporter (CaCA) (TC 2.A.19) family
16	61622.XP_010354433.1	0.546	Belongs to the heparin-binding growth factors family.
17	61622.XP_010368145.1	0.545	Solute carrier family 24 member 3
18	61622.XP_010363186.1	0.541	Forkhead box protein I1
19	61622.XP_010367865.1	0.541	Belongs to the histidine acid phosphatase family.
20	61622.XP_010382247.1	0.541	Amelotin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	1.000	DNA-binding transcription factor activity
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0001067	0.946	transcription regulatory region nucleic acid binding
GO:0000976	0.943	transcription cis-regulatory region binding
GO:0000981	0.925	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.808	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.518	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.482	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001216	0.426	DNA-binding transcription activator activity
GO:0001228	0.416	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048856	0.995	anatomical structure development
GO:0032501	0.992	multicellular organismal process
GO:0050789	0.990	regulation of biological process
GO:0050794	0.983	regulation of cellular process
GO:0009987	0.982	cellular process
GO:0007275	0.957	multicellular organism development
GO:0009653	0.916	anatomical structure morphogenesis
GO:0048518	0.901	positive regulation of biological process
GO:0048731	0.879	system development
GO:0048513	0.878	animal organ development
GO:0019222	0.873	regulation of metabolic process
GO:0060255	0.860	regulation of macromolecule metabolic process
GO:0031323	0.831	regulation of cellular metabolic process
GO:0050896	0.825	response to stimulus
GO:0048522	0.794	positive regulation of cellular process
GO:0080090	0.773	regulation of primary metabolic process
GO:0051171	0.773	regulation of nitrogen compound metabolic process
GO:0010468	0.769	regulation of gene expression
GO:0019219	0.758	regulation of nucleobase-containing compound metabolic process
GO:0009888	0.736	tissue development
GO:0051252	0.718	regulation of RNA metabolic process
GO:0009889	0.717	regulation of biosynthetic process
GO:0031326	0.647	regulation of cellular biosynthetic process
GO:0010556	0.645	regulation of macromolecule biosynthetic process
GO:0006355	0.641	regulation of DNA-templated transcription
GO:0030154	0.576	cell differentiation
GO:0009887	0.552	animal organ morphogenesis
GO:0051716	0.495	cellular response to stimulus
GO:0009893	0.495	positive regulation of metabolic process
GO:0010604	0.460	positive regulation of macromolecule metabolic process
GO:0006357	0.453	regulation of transcription by RNA polymerase II
GO:0045935	0.446	positive regulation of nucleobase-containing compound metabolic process
GO:0009891	0.427	positive regulation of biosynthetic process
GO:0051254	0.426	positive regulation of RNA metabolic process
GO:1902680	0.418	positive regulation of RNA biosynthetic process
GO:0050793	0.416	regulation of developmental process
GO:0007154	0.415	cell communication
GO:0045893	0.403	positive regulation of DNA-templated transcription
GO:0045944	0.392	positive regulation of transcription by RNA polymerase II
GO:0048519	0.354	negative regulation of biological process
GO:0007399	0.315	nervous system development
GO:0048523	0.313	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.971	intracellular organelle lumen
GO:0031981	0.725	nuclear lumen
GO:0005737	0.607	cytoplasm
GO:0005654	0.501	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]