StarFunc result for job id O60486

User Input

>input (1568 residues)
MEVSRRKAPPRPPRPAAPLPLLAYLLALAAPGRGADEPVWRSEQAIGAIAASQEDGVFVA
SGSCLDQLDYSLEHSLSRLYRDQAGNCTEPVSLAPPARPRPGSSFSKLLLPYREGAAGLG
GLLLTGWTFDRGACEVRPLGNLSRNSLRNGTEVVSCHPQGSTAGVVYRAGRNNRWYLAVA
ATYVLPEPETASRCNPAASDHDTAIALKDTEGRSLATQELGRLKLCEGAGSLHFVDAFLW
NGSIYFPYYPYNYTSGAATGWPSMARIAQSTEVLFQGQASLDCGHGHPDGRRLLLSSSLV
EALDVWAGVFSAAAGEGQERRSPTTTALCLFRMSEIQARAKRVSWDFKTAESHCKEGDQP
ERVQPIASSTLIHSDLTSVYGTVVMNRTVLFLGTGDGQLLKVILGENLTSNCPEVIYEIK
EETPVFYKLVPDPVKNIYIYLTAGKEVRRIRVANCNKHKSCSECLTATDPHCGWCHSLQR
CTFQGDCVHSENLENWLDISSGAKKCPKIQIIRSSKEKTTVTMVGSFSPRHSKCMVKNVD
SSRELCQNKSQPNRTCTCSIPTRATYKDVSVVNVMFSFGSWNLSDRFNFTNCSSLKECPA
CVETGCAWCKSARRCIHPFTACDPSDYERNQEQCPVAVEKTSGGGRPKENKGNRTNQALQ
VFYIKSIEPQKVSTLGKSNVIVTGANFTRASNITMILKGTSTCDKDVIQVSHVLNDTHMK
FSLPSSRKEMKDVCIQFDGGNCSSVGSLSYIALPHCSLIFPATTWISGGQNITMMGRNFD
VIDNLIISHELKGNINVSEYCVATYCGFLAPSLKSSKVRTNVTVKLRVQDTYLDCGTLQY
REDPRFTGYRVESEVDTELEVKIQKENDNFNISKKDIEITLFHGENGQLNCSFENITRNQ
DLTTILCKIKGIKTASTIANSSKKVRVKLGNLELYVEQESVPSTWYFLIVLPVLLVIVIF
AAVGVTRHKSKELSRKQSQQLELLESELRKEIRDGFAELQMDKLDVVDSFGTVPFLDYKH
FALRTFFPESGGFTHIFTEDMHNRDANDKNESLTALDALICNKSFLVTVIHTLEKQKNFS
VKDRCLFASFLTIALQTKLVYLTSILEVLTRDLMEQCSNMQPKLMLRRTESVVEKLLTNW
MSVCLSGFLRETVGEPFYLLVTTLNQKINKGPVDVITCKALYTLNEDWLLWQVPEFSTVA
LNVVFEKIPENESADVCRNISVNVLDCDTIGQAKEKIFQAFLSKNGSPYGLQLNEIGLEL
QMGTRQKELLDIDSSSVILEDGITKLNTIGHYEISNGSTIKVFKKIANFTSDVEYSDDHC
HLILPDSEAFQDVQGKRHRGKHKFKVKEMYLTKLLSTKVAIHSVLEKLFRSIWSLPNSRA
PFAIKYFFDFLDAQAENKKITDPDVVHIWKTNSLPLRFWVNILKNPQFVFDIKKTPHIDG
CLSVIAQAFMDAFSLTEQQLGKEAPTNKLLYAKDIPTYKEEVKSYYKAIRDLPPLSSSEM
EEFLTQESKKHENEFNEEVALTEIYKYIVKYFDEILNKLERERGLEEAQKQLLHVKVLFD
EKKKCKWM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9QZC2	0.526	0.524	0.000	1574	0.905	0.902	Q9QZC2.pdb.gz	PLXC1_MOUSE Plexin-C1 OS=Mus musculus OX=10090 GN=Plxnc1 PE=1 SV=1
2	AFDB:Q3UH93	0.344	0.284	1.961E-88	1925	0.318	0.259	Q3UH93.pdb.gz	PLXD1_MOUSE Plexin-D1 OS=Mus musculus OX=10090 GN=Plxnd1 PE=1 SV=1
3	PDB:6vxkB	0.440	0.894	1.965E-88	747	0.467	0.981	6vxkB.pdb.gz
4	AFDB:Q5RGW1	0.378	0.556	1.432E-83	1056	0.290	0.430	Q5RGW1.pdb.gz	Q5RGW1_DANRE Plexin C1 (Fragment) OS=Danio rerio OX=7955 GN=plxnc1 PE=1 SV=3
5	AFDB:Q9V491	0.344	0.279	8.956E-80	1945	0.271	0.219	Q9V491.pdb.gz	Q9V491_DROME Plexin A, isoform A OS=Drosophila melanogaster OX=7227 GN=PlexA PE=1 SV=1
6	AFDB:O15031	0.347	0.299	1.639E-79	1838	0.281	0.239	O15031.pdb.gz	PLXB2_HUMAN Plexin-B2 OS=Homo sapiens OX=9606 GN=PLXNB2 PE=1 SV=3
7	AFDB:F1QBC0	0.338	0.287	1.386E-78	1864	0.282	0.237	F1QBC0.pdb.gz	F1QBC0_DANRE Plexin b2a OS=Danio rerio OX=7955 GN=fk37b01 PE=1 SV=3
8	AFDB:Q6BEA0	0.369	0.308	1.443E-78	1903	0.285	0.235	Q6BEA0.pdb.gz	PLXA4_DANRE Plexin-A4 OS=Danio rerio OX=7955 GN=plxna4 PE=2 SV=1
9	AFDB:Q9UIW2	0.349	0.291	2.159E-78	1896	0.275	0.227	Q9UIW2.pdb.gz	PLXA1_HUMAN Plexin-A1 OS=Homo sapiens OX=9606 GN=PLXNA1 PE=1 SV=3
10	AFDB:B0S5N4	0.342	0.286	6.405E-78	1892	0.274	0.227	B0S5N4.pdb.gz	PLXA3_DANRE Plexin A3 OS=Danio rerio OX=7955 GN=plxna3 PE=2 SV=2
11	AFDB:B2RXS4	0.345	0.297	8.156E-78	1842	0.273	0.232	B2RXS4.pdb.gz	PLXB2_MOUSE Plexin-B2 OS=Mus musculus OX=10090 GN=Plxnb2 PE=1 SV=1
12	PDB:6qp7A	0.220	0.498	8.349E-13	620	0.052	0.131	6qp7A.pdb.gz	Diversity of oligomerization in Drosophila semaphorins suggests a mechanism of functional fine-tuning.
13	PDB:3nvqA	0.212	0.505	1.138E-10	588	0.058	0.155	3nvqA.pdb.gz
14	PDB:7nxdA	0.112	0.182	1.259E-7	905	0.057	0.099	7nxdA.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.
15	PDB:3fcsA	0.111	0.176	2.213E-7	913	0.055	0.094	3fcsA.pdb.gz	Structure of a complete integrin ectodomain in a physiologic resting state and activation and deactivation by applied forces.
16	PDB:6qk7B	0.141	0.262	1.469E-6	749	0.061	0.127	6qk7B.pdb.gz	Molecular basis of tRNA recognition by the Elongator complex.
17	PDB:5o9zw	0.150	0.193	3.711E-6	1140	0.067	0.092	5o9zw.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
18	PDB:2hyeA	0.145	0.189	5.780E-6	1140	0.064	0.089	2hyeA.pdb.gz	Molecular architecture and assembly of the DDB1-CUL4A ubiquitin ligase machinery.
19	PDB:7mq8LR	0.125	0.219	6.791E-6	773	0.061	0.123	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:4nenA	0.123	0.169	7.663E-6	1063	0.061	0.089	4nenA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60486	0.0	3265	1568	1.000	1.000	PLXC1_HUMAN Plexin-C1 OS=Homo sapiens OX=9606 GN=PLXNC1 PE=1 SV=1
2	Q5RGW1	0.0	732	1056	0.269	0.400	Q5RGW1_DANRE Plexin C1 (Fragment) OS=Danio rerio OX=7955 GN=plxnc1 PE=1 SV=3
3	Q9QZC2	0.0	2883	1574	0.906	0.903	PLXC1_MOUSE Plexin-C1 OS=Mus musculus OX=10090 GN=Plxnc1 PE=1 SV=1
4	Q3UH93	3.28e-168	558	1925	0.225	0.183	PLXD1_MOUSE Plexin-D1 OS=Mus musculus OX=10090 GN=Plxnd1 PE=1 SV=1
5	Q6DSU3	2.13e-166	552	1880	0.226	0.189	Q6DSU3_DANRE Plexin D1 OS=Danio rerio OX=7955 GN=zgc:77379 PE=1 SV=1
6	Q9Y4D7	3.85e-164	546	1925	0.221	0.180	PLXD1_HUMAN Plexin-D1 OS=Homo sapiens OX=9606 GN=PLXND1 PE=1 SV=3
7	F1Q7U0	1.89e-129	449	2220	0.200	0.141	F1Q7U0_DANRE Plexin b1b OS=Danio rerio OX=7955 GN=plxnb1b PE=1 SV=1
8	Q8CJH3	7.33e-127	441	2119	0.193	0.143	PLXB1_MOUSE Plexin-B1 OS=Mus musculus OX=10090 GN=Plxnb1 PE=1 SV=2
9	Q80UG2	1.71e-126	438	1893	0.200	0.166	PLXA4_MOUSE Plexin-A4 OS=Mus musculus OX=10090 GN=Plxna4 PE=1 SV=3
10	Q9HCM2	1.40e-125	436	1894	0.200	0.166	PLXA4_HUMAN Plexin-A4 OS=Homo sapiens OX=9606 GN=PLXNA4 PE=1 SV=4
11	O43157	1.35e-124	434	2135	0.194	0.142	PLXB1_HUMAN Plexin-B1 OS=Homo sapiens OX=9606 GN=PLXNB1 PE=1 SV=3
12	F1QBC0	2.65e-124	432	1864	0.195	0.164	F1QBC0_DANRE Plexin b2a OS=Danio rerio OX=7955 GN=fk37b01 PE=1 SV=3
13	Q9UIW2	6.01e-124	431	1896	0.162	0.134	PLXA1_HUMAN Plexin-A1 OS=Homo sapiens OX=9606 GN=PLXNA1 PE=1 SV=3
14	C5H5I1	1.17e-123	430	1864	0.194	0.163	C5H5I1_DANRE Plexin B2 OS=Danio rerio OX=7955 GN=plxnB2 PE=1 SV=1
15	B2RXS4	2.32e-123	429	1842	0.187	0.159	PLXB2_MOUSE Plexin-B2 OS=Mus musculus OX=10090 GN=Plxnb2 PE=1 SV=1
16	B0S5N4	8.21e-123	427	1892	0.160	0.133	PLXA3_DANRE Plexin A3 OS=Danio rerio OX=7955 GN=plxna3 PE=2 SV=2
17	O75051	1.44e-122	427	1894	0.207	0.172	PLXA2_HUMAN Plexin-A2 OS=Homo sapiens OX=9606 GN=PLXNA2 PE=1 SV=4
18	Q6BEA0	3.27e-122	426	1903	0.200	0.165	PLXA4_DANRE Plexin-A4 OS=Danio rerio OX=7955 GN=plxna4 PE=2 SV=1
19	P70207	3.37e-122	426	1894	0.204	0.169	PLXA2_MOUSE Plexin-A2 OS=Mus musculus OX=10090 GN=Plxna2 PE=1 SV=2
20	A0A2R8QPJ6	9.24e-122	424	1902	0.228	0.188	A0A2R8QPJ6_DANRE Plexin-A2 OS=Danio rerio OX=7955 GN=plxna2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19482 DUF6018	2.3e+02	13.1	Family of unknown function (DUF6018)
2	PF08337 Plexin_cytopl	7.6e-168	570.6	Plexin cytoplasmic RasGAP domain
3	PF20170 Plexin_RBD	7.4e-27	105.2	Plexin cytoplasmic RhoGTPase-binding domain
4	PF01437 PSI	5.4e-12	57.4	Plexin repeat
5	PF01403 Sema	0.0031	28.9	Sema domain
6	PF01833 TIG	1.8e-08	45.7	IPT/TIG domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000258526

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261918	0.999	Semaphorin-7A
2	9606.ENSP00000265371	0.992	Neuropilin-1
3	9606.ENSP00000484146	0.991	Semaphorin-3B
4	9606.ENSP00000265362	0.976	Semaphorin-3A
5	9606.ENSP00000002829	0.973	Semaphorin-3F
6	9606.ENSP00000303212	0.950	Semaphorin-3E
7	9606.ENSP00000416523	0.943	Semaphorin-4D
8	9606.ENSP00000265361	0.912	Semaphorin-3C
9	9606.ENSP00000467290	0.889	Semaphorin-6B
10	9606.ENSP00000371936	0.887	Semaphorin-5A
11	9606.ENSP00000257414	0.886	Semaphorin-6A
12	9606.ENSP00000284136	0.886	Semaphorin-3D
13	9606.ENSP00000324857	0.886	Semaphorin-6D
14	9606.ENSP00000357909	0.886	Semaphorin-6C
15	9606.ENSP00000389588	0.886	Semaphorin-5B
16	9606.ENSP00000353582	0.851	Neuropilin-2
17	9606.ENSP00000360158	0.764	Fibrocystin
18	9606.ENSP00000380942	0.750	Rho guanine nucleotide exchange factor 12
19	9606.ENSP00000385720	0.739	Rho GTPase-activating protein 35
20	9606.ENSP00000309539	0.673	Dihydropyrimidinase-related protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	0.997	signaling receptor binding
GO:0004888	0.985	transmembrane signaling receptor activity
GO:0017154	0.840	semaphorin receptor activity
GO:0003824	0.346	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0065007	0.929	biological regulation
GO:0007155	0.914	cell adhesion
GO:0050794	0.890	regulation of cellular process
GO:0050896	0.725	response to stimulus
GO:0032502	0.568	developmental process
GO:0048856	0.514	anatomical structure development
GO:0023052	0.466	signaling
GO:0007154	0.463	cell communication
GO:0032501	0.449	multicellular organismal process
GO:0051716	0.422	cellular response to stimulus
GO:0051128	0.411	regulation of cellular component organization
GO:0007165	0.397	signal transduction
GO:0007275	0.328	multicellular organism development
GO:0007166	0.309	cell surface receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.998	membrane
GO:0071944	0.997	cell periphery
GO:0005886	0.972	plasma membrane
GO:0043227	0.707	membrane-bounded organelle
GO:0005622	0.678	intracellular anatomical structure
GO:0030054	0.570	cell junction
GO:0045202	0.400	synapse
GO:0005737	0.312	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]