StarFunc result for job id O60487

User Input

>input (215 residues)
MYGKSSTRAVLLLLGIQLTALWPIAAVEIYTSRVLEAVNGTDARLKCTFSSFAPVGDALT
VTWNFRPLDGGPEQFVFYYHIDPFQPMSGRFKDRVSWDGNPERYDASILLWKLQFDDNGT
YTCQVKNPPDVDGVIGEIRLSVVHTVRFSEIHFLALAIGSACALMIIIVIVVVLFQHYRK
KRWAERAHKVVEIKSKEEERLNQEKKVSVYLEDTD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60487	1.000	1.000	5.239E-37	215	1.000	1.000	O60487.pdb.gz	MPZL2_HUMAN Myelin protein zero-like protein 2 OS=Homo sapiens OX=9606 GN=MPZL2 PE=1 SV=1
2	AFDB:O70255	0.741	0.741	6.102E-31	215	0.819	0.819	O70255.pdb.gz	MPZL2_MOUSE Myelin protein zero-like protein 2 OS=Mus musculus OX=10090 GN=Mpzl2 PE=1 SV=1
3	AFDB:A2BGB5	0.596	0.640	1.220E-18	199	0.335	0.362	A2BGB5.pdb.gz
4	AFDB:P06907	0.833	0.727	6.436E-18	248	0.256	0.222	P06907.pdb.gz	MYP0_RAT Myelin protein P0 OS=Rattus norvegicus OX=10116 GN=Mpz PE=1 SV=1
5	AFDB:A0A2R8QN30	0.641	0.608	1.398E-17	228	0.265	0.250	A0A2R8QN30.pdb.gz	A0A2R8QN30_DANRE Myelin protein P0 isoform X1 OS=Danio rerio OX=7955 GN=p0 PE=1 SV=1
6	AFDB:O95297	0.639	0.520	2.434E-17	269	0.279	0.223	O95297.pdb.gz	MPZL1_HUMAN Myelin protein zero-like protein 1 OS=Homo sapiens OX=9606 GN=MPZL1 PE=1 SV=1
7	AFDB:Q6UWV2	0.571	0.524	1.694E-16	235	0.247	0.226	Q6UWV2.pdb.gz	MPZL3_HUMAN Myelin protein zero-like protein 3 OS=Homo sapiens OX=9606 GN=MPZL3 PE=1 SV=1
8	AFDB:Q3V3F6	0.577	0.526	1.893E-16	237	0.242	0.219	Q3V3F6.pdb.gz	MPZL3_MOUSE Myelin protein zero-like protein 3 OS=Mus musculus OX=10090 GN=Mpzl3 PE=1 SV=3
9	AFDB:E7F7T2	0.645	0.537	3.482E-16	264	0.265	0.216	E7F7T2.pdb.gz	E7F7T2_DANRE Myelin protein zero-like 1 like OS=Danio rerio OX=7955 GN=zgc:110608 PE=1 SV=1
10	AFDB:A4JYI5	0.550	0.498	6.407E-16	238	0.209	0.189	A4JYI5.pdb.gz
11	PDB:3oaiA	0.529	0.237	2.346E-14	488	0.205	0.090	3oaiA.pdb.gz	Crystal structure of the extracellular domain of human myelin protein zero.
12	PDB:5ir3A	0.455	0.833	9.532E-9	111	0.116	0.225	5ir3A.pdb.gz
13	PDB:1cd0A	0.431	0.786	2.189E-8	111	0.130	0.252	1cd0A.pdb.gz
14	PDB:2cd0A	0.433	0.787	2.803E-7	111	0.116	0.225	2cd0A.pdb.gz
15	PDB:4aizA	0.426	0.819	3.310E-7	107	0.107	0.215	4aizA.pdb.gz	Site-Directed Mutagenesis Reveals Regions Implicated in the Stability and Fiber Formation of Human Lambda3R Light Chains.
16	PDB:4fqqL	0.424	0.428	6.090E-7	213	0.116	0.117	4fqqL.pdb.gz
17	PDB:2qhrL	0.421	0.416	8.035E-7	218	0.116	0.115	2qhrL.pdb.gz	Complex of a protective antibody with its Ebola virus GP peptide epitope: unusual features of a V lambda x light chain.
18	PDB:1ngwH	0.430	0.428	1.003E-6	216	0.074	0.074	1ngwH.pdb.gz	Structural evidence for substrate strain in antibody catalysis
19	PDB:1ezvX	0.439	0.705	1.563E-6	127	0.093	0.157	1ezvX.pdb.gz	Structure at 2.3 A resolution of the cytochrome bc(1) complex from the yeast Saccharomyces cerevisiae co-crystallized with an antibody Fv fragment.
20	PDB:1hzhH	0.417	0.212	1.652E-6	457	0.102	0.048	1hzhH.pdb.gz	Crystal structure of a neutralizing human IGG against HIV-1: a template for vaccine design.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60487	7.49e-162	447	215	1.000	1.000	MPZL2_HUMAN Myelin protein zero-like protein 2 OS=Homo sapiens OX=9606 GN=MPZL2 PE=1 SV=1
2	O70255	4.16e-118	336	215	0.819	0.819	MPZL2_MOUSE Myelin protein zero-like protein 2 OS=Mus musculus OX=10090 GN=Mpzl2 PE=1 SV=1
3	Q8JG36	8.79e-42	142	199	0.326	0.352	Q8JG36_DANRE Epithelial V-like antigen 1 OS=Danio rerio OX=7955 GN=mpzl2 PE=1 SV=1
4	E7F7T2	1.20e-24	99.8	264	0.288	0.235	E7F7T2_DANRE Myelin protein zero-like 1 like OS=Danio rerio OX=7955 GN=zgc:110608 PE=1 SV=1
5	Q56A07	2.51e-24	97.4	215	0.260	0.260	SCN2B_MOUSE Sodium channel subunit beta-2 OS=Mus musculus OX=10090 GN=Scn2b PE=1 SV=1
6	O60939	3.92e-24	97.1	215	0.260	0.260	SCN2B_HUMAN Sodium channel subunit beta-2 OS=Homo sapiens OX=9606 GN=SCN2B PE=1 SV=1
7	O95297	5.35e-24	98.2	269	0.274	0.219	MPZL1_HUMAN Myelin protein zero-like protein 1 OS=Homo sapiens OX=9606 GN=MPZL1 PE=1 SV=1
8	Q6UWV2	2.37e-23	95.5	235	0.274	0.251	MPZL3_HUMAN Myelin protein zero-like protein 3 OS=Homo sapiens OX=9606 GN=MPZL3 PE=1 SV=1
9	P25189	3.07e-23	95.5	248	0.237	0.206	MYP0_HUMAN Myelin protein P0 OS=Homo sapiens OX=9606 GN=MPZ PE=1 SV=1
10	Q3V3F6	4.78e-23	94.7	237	0.233	0.211	MPZL3_MOUSE Myelin protein zero-like protein 3 OS=Mus musculus OX=10090 GN=Mpzl3 PE=1 SV=3
11	P54900	7.46e-23	93.6	215	0.265	0.265	SCN2B_RAT Sodium channel subunit beta-2 OS=Rattus norvegicus OX=10116 GN=Scn2b PE=1 SV=1
12	P27573	1.54e-22	93.6	248	0.233	0.202	MYP0_MOUSE Myelin protein P0 OS=Mus musculus OX=10090 GN=Mpz PE=1 SV=1
13	P06907	1.75e-22	93.6	248	0.233	0.202	MYP0_RAT Myelin protein P0 OS=Rattus norvegicus OX=10116 GN=Mpz PE=1 SV=1
14	A0A2R8QN30	2.56e-22	92.8	228	0.260	0.246	A0A2R8QN30_DANRE Myelin protein P0 isoform X1 OS=Danio rerio OX=7955 GN=p0 PE=1 SV=1
15	Q8JFG6	3.71e-22	91.7	203	0.260	0.276	Q8JFG6_DANRE Myelin protein P0 precursor OS=Danio rerio OX=7955 GN=p0 PE=1 SV=1
16	A0A0R4IS04	4.96e-22	91.7	212	0.260	0.264	A0A0R4IS04_DANRE Myelin protein P0 isoform X2 OS=Danio rerio OX=7955 GN=p0 PE=1 SV=1
17	Q6NW73	5.85e-17	78.2	215	0.158	0.158	Q6NW73_DANRE Myelin protein zero-like 3 OS=Danio rerio OX=7955 GN=zgc:85923 PE=1 SV=1
18	Q5DX21	4.97e-09	57.4	431	0.195	0.097	IGS11_HUMAN Immunoglobulin superfamily member 11 OS=Homo sapiens OX=9606 GN=IGSF11 PE=1 SV=3
19	Q8BHK2	2.51e-08	54.3	215	0.140	0.140	SCN3B_MOUSE Sodium channel subunit beta-3 OS=Mus musculus OX=10090 GN=Scn3b PE=1 SV=1
20	Q9JK00	4.29e-08	53.9	215	0.140	0.140	SCN3B_RAT Sodium channel subunit beta-3 OS=Rattus norvegicus OX=10116 GN=Scn3b PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05568 ASFV_J13L	3.5e+02	12.3	African swine fever virus J13L protein
2	PF14316 DUF4381	4.8e+02	12.4	Domain of unknown function (DUF4381)
3	PF20113 DUF6503	3.8e+02	11.9	Family of unknown function (DUF6503)
4	PF07679 I-set	3.3	19.1	Immunoglobulin I-set domain
5	PF00047 ig	4.6e-06	38.0	Immunoglobulin domain
6	PF13895 Ig_2	13	17.5	Immunoglobulin domain
7	PF13927 Ig_3	0.61	22.0	Immunoglobulin domain
8	PF15102 TMEM154	96	14.2	TMEM154 protein family
9	PF07686 V-set	5.7e-20	82.9	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000278937

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000367952	0.748	Unique cartilage matrix-associated protein
2	9606.ENSP00000278949	0.716	Myelin protein zero-like protein 3
3	9606.ENSP00000442770	0.702	GPN-loop GTPase 3
4	9606.ENSP00000369860	0.699	Motile sperm domain-containing protein 2
5	9606.ENSP00000382349	0.689	Acyl-coenzyme A synthetase ACSM4, mitochondrial
6	9606.ENSP00000344996	0.681	Paralemmin-3
7	9606.ENSP00000382237	0.667	Transmembrane protein 26
8	9606.ENSP00000356465	0.656	Ras-related protein Rab-32
9	9606.ENSP00000359540	0.630	Protein CREG1
10	9606.ENSP00000300255	0.624	Protein eva-1 homolog C
11	9606.ENSP00000281471	0.619	Protein AMN1 homolog
12	9606.ENSP00000427975	0.611	Ran-binding protein 17
13	9606.ENSP00000349678	0.584	Myosin-binding protein H-like
14	9606.ENSP00000233712	0.548	Protein eva-1 homolog A
15	9606.ENSP00000270722	0.545	PR domain zinc finger protein 16
16	9606.ENSP00000262999	0.544	Mitochondrial brown fat uncoupling protein 1
17	9606.ENSP00000357005	0.513	Junctional adhesion molecule A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007155	0.996	cell adhesion
GO:0032502	0.979	developmental process
GO:0048856	0.971	anatomical structure development
GO:0098609	0.951	cell-cell adhesion
GO:0098742	0.625	cell-cell adhesion via plasma-membrane adhesion molecules
GO:0007156	0.596	homophilic cell adhesion via plasma membrane adhesion molecules
GO:0032501	0.376	multicellular organismal process
GO:0065007	0.341	biological regulation
GO:0050789	0.305	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.997	organelle
GO:0005622	0.990	intracellular anatomical structure
GO:0043229	0.984	intracellular organelle
GO:0016020	0.945	membrane
GO:0005886	0.903	plasma membrane
GO:0043232	0.751	intracellular non-membrane-bounded organelle
GO:0043227	0.694	membrane-bounded organelle
GO:0005737	0.611	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]