StarFunc result for job id O60488

User Input

>input (711 residues)
MKLKLNVLTIILLPVHLLITIYSALIFIPWYFLTNAKKKNAMAKRIKAKPTSDKPGSPYR
SVTHFDSLAVIDIPGADTLDKLFDHAVSKFGKKDSLGTREILSEENEMQPNGKVFKKLIL
GNYKWMNYLEVNRRVNNFGSGLTALGLKPKNTIAIFCETRAEWMIAAQTCFKYNFPLVTL
YATLGKEAVVHGLNESEASYLITSVELLESKLKTALLDISCVKHIIYVDNKAINKAEYPE
GFEIHSMQSVEELGSNPENLGIPPSRPTPSDMAIVMYTSGSTGRPKGVMMHHSNLIAGMT
GQCERIPGLGPKDTYIGYLPLAHVLELTAEISCFTYGCRIGYSSPLTLSDQSSKIKKGSK
GDCTVLKPTLMAAVPEIMDRIYKNVMSKVQEMNYIQKTLFKIGYDYKLEQIKKGYDAPLC
NLLLFKKVKALLGGNVRMMLSGGAPLSPQTHRFMNVCFCCPIGQGYGLTESCGAGTVTEV
TDYTTGRVGAPLICCEIKLKDWQEGGYTINDKPNPRGEIVIGGQNISMGYFKNEEKTAED
YSVDENGQRWFCTGDIGEFHPDGCLQIIDRKKDLVKLQAGEYVSLGKVEAALKNCPLIDN
ICAFAKSDQSYVISFVVPNQKRLTLLAQQKGVEGTWVDICNNPAMEAEILKEIREAANAM
KLERFEIPIKVRLSPEPWTPETGLVTDAFKLKRKELRNHYLKDIERMYGGK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1R452	0.984	0.991	0.000	706	0.741	0.746	F1R452.pdb.gz
2	AFDB:O35547	0.997	0.997	0.000	711	0.975	0.975	O35547.pdb.gz	ACSL4_RAT Long-chain-fatty-acid--CoA ligase 4 OS=Rattus norvegicus OX=10116 GN=Acsl4 PE=1 SV=2
3	AFDB:O95573	0.975	0.963	0.000	720	0.653	0.644	O95573.pdb.gz	ACSL3_HUMAN Fatty acid CoA ligase Acsl3 OS=Homo sapiens OX=9606 GN=ACSL3 PE=1 SV=3
4	AFDB:A0A0B4KFE4	0.941	0.920	6.854E-92	728	0.467	0.456	A0A0B4KFE4.pdb.gz	A0A0B4KFE4_DROME Acyl-CoA synthetase long-chain, isoform J OS=Drosophila melanogaster OX=7227 GN=Acsl PE=1 SV=1
5	AFDB:Q9CAP8	0.907	0.933	7.682E-92	691	0.439	0.452	Q9CAP8.pdb.gz	LACS9_ARATH Long chain acyl-CoA synthetase 9, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LACS9 PE=1 SV=1
6	AFDB:Q9SJD4	0.906	0.895	1.001E-90	720	0.443	0.438	Q9SJD4.pdb.gz	LACS8_ARATH Long chain acyl-CoA synthetase 8 OS=Arabidopsis thaliana OX=3702 GN=LACS8 PE=1 SV=1
7	AFDB:Q20121	0.938	0.913	9.256E-90	731	0.443	0.431	Q20121.pdb.gz	Q20121_CAEEL AMP-binding domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=acs-4 PE=1 SV=2
8	AFDB:Q9P7D7	0.872	0.898	2.644E-71	689	0.309	0.319	Q9P7D7.pdb.gz	LCF2_SCHPO Long-chain-fatty-acid--CoA ligase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lcf2 PE=3 SV=1
9	AFDB:C8V333	0.869	0.884	3.517E-71	698	0.312	0.318	C8V333.pdb.gz	C8V333_EMENI Fatty acid activator Faa4, putative (AFU_orthologue AFUA_2G09910) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06014 PE=4 SV=1
10	AFDB:O60135	0.873	0.917	3.517E-71	676	0.302	0.318	O60135.pdb.gz	LCF1_SCHPO Long-chain-fatty-acid--CoA ligase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lcf1 PE=3 SV=1
11	PDB:5bsmA	0.622	0.820	2.721E-36	530	0.218	0.292	5bsmA.pdb.gz	Structural Basis for Specificity and Flexibility in a Plant 4-Coumarate:CoA Ligase.
12	PDB:6q2mA	0.639	0.822	3.348E-35	544	0.174	0.228	6q2mA.pdb.gz	Mutagenesis and Structural Studies Reveal the Basis for the Activity and Stability Properties That Distinguish thePhotinusLuciferasesscintillansandpyralis.
13	PDB:1ultA	0.529	0.689	9.895E-35	533	0.184	0.246	1ultA.pdb.gz
14	PDB:7kydA	0.629	0.822	3.097E-34	534	0.174	0.232	7kydA.pdb.gz	FruitFire: a luciferase based on a fruit fly metabolic enzyme.
15	PDB:5ie2A	0.582	0.798	3.471E-34	506	0.188	0.265	5ie2A.pdb.gz	Crystal Structures of Arabidopsis thaliana Oxalyl-CoA Synthetase Essential for Oxalate Degradation
16	PDB:3r44A	0.499	0.684	2.503E-32	502	0.177	0.251	3r44A.pdb.gz	The Mycobacterium tuberculosis Very-Long-Chain Fatty Acyl-CoA Synthetase: Structural Basis for Housing Lipid Substrates Longer than the Enzyme.
17	PDB:2p20A	0.527	0.580	2.747E-31	641	0.158	0.175	2p20A.pdb.gz	Biochemical and Crystallographic Analysis of Substrate Binding and Conformational Changes in Acetyl-CoA Synthetase.
18	PDB:5ja2A	0.515	0.304	4.011E-30	1238	0.136	0.078	5ja2A.pdb.gz	Structures of a Nonribosomal Peptide Synthetase Module Bound to MbtH-like Proteins Support a Highly Dynamic Domain Architecture.
19	PDB:1ry2A	0.608	0.697	2.351E-29	615	0.134	0.154	1ry2A.pdb.gz	Crystal structure of yeast acetyl-coenzyme A synthetase in complex with AMP
20	PDB:3b7wA	0.505	0.653	3.310E-29	537	0.145	0.192	3b7wA.pdb.gz	Structural snapshots for the conformation-dependent catalysis by human medium-chain acyl-coenzyme A synthetase ACSM2A.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0B4KFE4	0.0	634	728	0.484	0.473	A0A0B4KFE4_DROME Acyl-CoA synthetase long-chain, isoform J OS=Drosophila melanogaster OX=7227 GN=Acsl PE=1 SV=1
2	A1Z7H2	0.0	636	717	0.478	0.474	A1Z7H2_DROME Acyl-CoA synthetase long-chain, isoform D OS=Drosophila melanogaster OX=7227 GN=Acsl PE=1 SV=1
3	A1Z7H3	0.0	636	707	0.478	0.481	A1Z7H3_DROME Acyl-CoA synthetase long-chain, isoform C OS=Drosophila melanogaster OX=7227 GN=Acsl PE=1 SV=1
4	O35547	0.0	1444	711	0.975	0.975	ACSL4_RAT Long-chain-fatty-acid--CoA ligase 4 OS=Rattus norvegicus OX=10116 GN=Acsl4 PE=1 SV=2
5	O60488	0.0	1473	711	1.000	1.000	ACSL4_HUMAN Long-chain-fatty-acid--CoA ligase 4 OS=Homo sapiens OX=9606 GN=ACSL4 PE=1 SV=2
6	O95573	0.0	991	720	0.655	0.647	ACSL3_HUMAN Fatty acid CoA ligase Acsl3 OS=Homo sapiens OX=9606 GN=ACSL3 PE=1 SV=3
7	Q20121	0.0	606	731	0.444	0.432	Q20121_CAEEL AMP-binding domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=acs-4 PE=1 SV=2
8	Q63151	0.0	976	720	0.657	0.649	ACSL3_RAT Fatty acid CoA ligase Acsl3 OS=Rattus norvegicus OX=10116 GN=Acsl3 PE=1 SV=1
9	Q6PFP1	0.0	1137	706	0.736	0.741	Q6PFP1_DANRE Acsl4a protein OS=Danio rerio OX=7955 GN=acsl4 PE=1 SV=1
10	Q8T3L1	0.0	637	715	0.478	0.476	Q8T3L1_DROME Acyl-CoA synthetase long-chain, isoform A OS=Drosophila melanogaster OX=7227 GN=Acsl PE=1 SV=1
11	Q9CAP8	0.0	608	691	0.451	0.465	LACS9_ARATH Long chain acyl-CoA synthetase 9, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LACS9 PE=1 SV=1
12	Q9QUJ7	0.0	1438	711	0.968	0.968	ACSL4_MOUSE Long-chain-fatty-acid--CoA ligase 4 OS=Mus musculus OX=10090 GN=Acsl4 PE=1 SV=2
13	Q9SJD4	0.0	620	720	0.435	0.429	LACS8_ARATH Long chain acyl-CoA synthetase 8 OS=Arabidopsis thaliana OX=3702 GN=LACS8 PE=1 SV=1
14	Q960I0	3.68e-161	473	434	0.325	0.532	Q960I0_DROME LP07340p OS=Drosophila melanogaster OX=7227 GN=Acsl PE=2 SV=1
15	C8V333	3.22e-116	367	698	0.311	0.317	C8V333_EMENI Fatty acid activator Faa4, putative (AFU_orthologue AFUA_2G09910) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06014 PE=4 SV=1
16	Q55DR6	7.07e-114	360	667	0.314	0.334	FCSA_DICDI Fatty acyl-CoA synthetase A OS=Dictyostelium discoideum OX=44689 GN=fcsA PE=1 SV=1
17	Q8LKS5	1.55e-110	352	700	0.309	0.314	LACS7_ARATH Long chain acyl-CoA synthetase 7, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=LACS7 PE=1 SV=2
18	Q1ZXQ4	2.05e-108	345	673	0.314	0.331	FCSB_DICDI Fatty acyl-CoA synthetase B OS=Dictyostelium discoideum OX=44689 GN=fcsB PE=2 SV=1
19	Q8LPS1	3.46e-108	346	701	0.315	0.320	LACS6_ARATH Long chain acyl-CoA synthetase 6, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=LACS6 PE=1 SV=1
20	O60135	2.21e-107	343	676	0.300	0.315	LCF1_SCHPO Long-chain-fatty-acid--CoA ligase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lcf1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00501 AMP-binding	3.8e-101	350.4	AMP-binding enzyme
2	PF13193 AMP-binding_C	0.027	26.8	AMP-binding enzyme C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000339787

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000293217	0.958	Peroxisomal acyl-coenzyme A oxidase 1
2	9606.ENSP00000307697	0.951	Peroxisomal acyl-coenzyme A oxidase 2
3	9606.ENSP00000304592	0.948	Fatty acid synthase
4	9606.ENSP00000233710	0.947	Long-chain specific acyl-CoA dehydrogenase, mitochondrial
5	9606.ENSP00000278840	0.934	Fatty acid desaturase 2
6	9606.ENSP00000262844	0.930	AMME syndrome candidate gene 1 protein
7	9606.ENSP00000378105	0.915	Elongation of very long chain fatty acids protein 6
8	9606.ENSP00000477602	0.912	Elongation of very long chain fatty acids protein 1
9	9606.ENSP00000265052	0.861	Monoglyceride lipase
10	9606.ENSP00000479919	0.860	Endophilin-B1
11	9606.ENSP00000309757	0.841	Lipoprotein lipase
12	9606.ENSP00000265641	0.825	Carnitine O-palmitoyltransferase 1, liver isoform
13	9606.ENSP00000331902	0.825	Collagen alpha-5(IV) chain
14	9606.ENSP00000350012	0.788	Long-chain-fatty-acid--CoA ligase 3
15	9606.ENSP00000392985	0.779	Oxidoreductase HTATIP2
16	9606.ENSP00000361173	0.768	Potassium voltage-gated channel subfamily E regulatory beta subunit 5
17	9606.ENSP00000379011	0.757	Carnitine O-palmitoyltransferase 1, muscle isoform
18	9606.ENSP00000376303	0.744	Carnitine O-palmitoyltransferase 1, brain isoform
19	9606.ENSP00000337701	0.741	Patatin-like phospholipase domain-containing protein 2
20	9606.ENSP00000359380	0.736	Acyl-CoA desaturase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004467	1.000	long-chain fatty acid-CoA ligase activity
GO:0005488	0.859	binding
GO:0005515	0.854	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0035337	0.985	fatty-acyl-CoA metabolic process
GO:0035384	0.978	thioester biosynthetic process
GO:0034030	0.976	ribonucleoside bisphosphate biosynthetic process
GO:0034033	0.976	purine nucleoside bisphosphate biosynthetic process
GO:0046390	0.975	ribose phosphate biosynthetic process
GO:0071616	0.974	acyl-CoA biosynthetic process
GO:1901570	0.950	fatty acid derivative biosynthetic process
GO:0050789	0.949	regulation of biological process
GO:0006631	0.948	fatty acid metabolic process
GO:0048518	0.887	positive regulation of biological process
GO:0001676	0.860	long-chain fatty acid metabolic process
GO:0032501	0.856	multicellular organismal process
GO:0050794	0.811	regulation of cellular process
GO:0032502	0.673	developmental process
GO:0032879	0.617	regulation of localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.994	endomembrane system
GO:0005739	0.993	mitochondrion
GO:0031090	0.964	organelle membrane
GO:0031967	0.785	organelle envelope
GO:0005789	0.733	endoplasmic reticulum membrane
GO:0098588	0.337	bounding membrane of organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:15421	1.000	a long-chain fatty acid + ATP + CoA = a long-chain fatty acyl-CoA + AMP + diphosphate
EC:6.2.1.3	1.000	long-chain-fatty-acid--CoA ligase.

[back to server]