StarFunc result for job id O60494

User Input

>input (1400 residues)
MMNMSLPFLWSLLTLLIFAEVNGEAGELELQRQKRSINLQQPRMATERGNLVFLTGSAQN
IEFRTGSLGKIKLNDEDLSECLHQIQKNKEDIIELKGSAIGLPQNISSQIYQLNSKLVDL
ERKFQGLQQTVDKKVCSSNPCQNGGTCLNLHDSFFCICPPQWKGPLCSADVNECEIYSGT
PLSCQNGGTCVNTMGSYSCHCPPETYGPQCASKYDDCEGGSVARCVHGICEDLMREQAGE
PKYSCVCDAGWMFSPNSPACTLDRDECSFQPGPCSTLVQCFNTQGSFYCGACPTGWQGNG
YICEDINECEINNGGCSVAPPVECVNTPGSSHCQACPPGYQGDGRVCTLTDICSVSNGGC
HPDASCSSTLGSLPLCTCLPGYTGNGYGPNGCVQLSNICLSHPCLNGQCIDTVSGYFCKC
DSGWTGVNCTENINECLSNPCLNGGTCVDGVDSFSCECTRLWTGALCQVPQQVCGESLSG
INGSFSYRSPDVGYVHDVNCFWVIKTEMGKVLRITFTFFRLESMDNCPHEFLQVYDGDSS
SAFQLGRFCGSSLPHELLSSDNALYFHLYSEHLRNGRGFTVRWETQQPECGGILTGPYGS
IKSPGYPGNYPPGRDCVWIVVTSPDLLVTFTFGTLSLEHHDDCNKDYLEIRDGPLYQDPL
LGKFCTTFSVPPLQTTGPFARIHFHSDSQISDQGFHITYLTSPSDLRCGGNYTDPEGELF
LPELSGPFTHTRQCVYMMKQPQGEQIQINFTHVELQCQSDSSQNYIEVRDGETLLGKVCG
NGTISHIKSITNSVWIRFKIDASVEKASFRAVYQVACGDELTGEGVIRSPFFPNVYPGER
TCRWTIHQPQSQVILLNFTVFEIGSSAHCETDYVEIGSSSILGSPENKKYCGTDIPSFIT
SVYNFLYVTFVKSSSTENHGFMAKFSAEDLACGEILTESTGTIQSPGHPNVYPHGINCTW
HILVQPNHLIHLMFETFHLEFHYNCTNDYLEVYDTDSETSLGRYCGKSIPPSLTSSGNSL
MLVFVTDSDLAYEGFLINYEAISAATACLQDYTDDLGTFTSPNFPNNYPNNWECIYRITV
RTGQLIAVHFTNFSLEEAIGNYYTDFLEIRDGGYEKSPLLGIFYGSNLPPTIISHSNKLW
LKFKSDQIDTRSGFSAYWDGSSTGCGGNLTTSSGTFISPNYPMPYYHSSECYWWLKSSHG
SAFELEFKDFHLEHHPNCTLDYLAVYDGPSSNSHLLTQLCGDEKPPLIRSSGDSMFIKLR
TDEGQQGRGFKAEYRQTCENVVIVNQTYGILESIGYPNPYSENQHCNWTIRATTGNTVNY
TFLAFDLEHHINCSTDYLELYDGPRQMGRYCGVDLPPPGSTTSSKLQVLLLTDGVGRREK
GFQMQWFVYGCGGELSGATG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43897	0.154	0.194	2.997E-53	1013	0.149	0.205	O43897.pdb.gz	TLL1_HUMAN Tolloid-like protein 1 OS=Homo sapiens OX=9606 GN=TLL1 PE=1 SV=1
2	AFDB:O57460	0.150	0.171	3.785E-53	1022	0.142	0.195	O57460.pdb.gz	TLL1_DANRE Dorsal-ventral patterning tolloid-like protein 1 OS=Danio rerio OX=7955 GN=tll1 PE=2 SV=1
3	AFDB:Q8JI28	0.145	0.185	3.557E-52	1007	0.140	0.195	Q8JI28.pdb.gz	TLL1_XENLA Tolloid-like protein 1 OS=Xenopus laevis OX=8355 GN=tll1 PE=1 SV=1
4	AFDB:Q9Y6L7	0.167	0.209	4.931E-52	1015	0.149	0.205	Q9Y6L7.pdb.gz	TLL2_HUMAN Tolloid-like protein 2 OS=Homo sapiens OX=9606 GN=TLL2 PE=1 SV=1
5	AFDB:P98063	0.203	0.271	3.844E-51	991	0.139	0.196	P98063.pdb.gz	BMP1_MOUSE Bone morphogenetic protein 1 OS=Mus musculus OX=10090 GN=Bmp1 PE=1 SV=2
6	AFDB:A0A2R8QEK5	0.141	0.183	5.851E-51	986	0.136	0.194	A0A2R8QEK5.pdb.gz
7	AFDB:P25723	0.164	0.209	1.216E-49	1067	0.136	0.178	P25723.pdb.gz	TLD_DROME Dorsal-ventral patterning protein tolloid OS=Drosophila melanogaster OX=7227 GN=tld PE=2 SV=2
8	AFDB:Q9VC47	0.162	0.155	1.090E-48	1464	0.135	0.129	Q9VC47.pdb.gz	TOK_DROME Protein tolkin OS=Drosophila melanogaster OX=7227 GN=tok PE=1 SV=1
9	AFDB:Q60997	0.120	0.088	5.942E-46	2085	0.151	0.102	Q60997.pdb.gz	DMBT1_MOUSE Deleted in malignant brain tumors 1 protein OS=Mus musculus OX=10090 GN=Dmbt1 PE=1 SV=2
10	AFDB:G5EDX3	0.112	0.160	1.559E-38	906	0.113	0.174	G5EDX3.pdb.gz	G5EDX3_CAEEL CUB domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=lev-10 PE=2 SV=1
11	PDB:7kveB	0.075	0.076	5.539E-10	1374	0.091	0.092	7kveB.pdb.gz
12	PDB:4bxsV	0.064	0.069	2.973E-9	1262	0.087	0.097	4bxsV.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
13	PDB:7b01A	0.067	0.147	1.387E-8	588	0.038	0.090	7b01A.pdb.gz	Crystal structure of ADAMTS13 CUB domains reveals their role in global latency.
14	PDB:7q1yA	0.058	0.058	2.544E-8	1374	0.065	0.066	7q1yA.pdb.gz
15	PDB:7sqcO0	0.049	0.056	8.172E-8	1140	0.059	0.072	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
16	PDB:5n4lA	0.071	0.084	2.391E-7	1034	0.057	0.077	5n4lA.pdb.gz	Rat ceruloplasmin: a new labile copper binding site and zinc/copper mosaic.
17	PDB:7q5zA	0.061	0.063	4.186E-7	1344	0.061	0.063	7q5zA.pdb.gz
18	PDB:5a42A	0.062	0.058	3.419E-6	1597	0.071	0.062	5a42A.pdb.gz
19	PDB:7q3nU	0.049	0.190	3.933E-6	292	0.048	0.229	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
20	PDB:1kcwA	0.059	0.073	6.572E-6	1017	0.053	0.073	1kcwA.pdb.gz	The X-ray structure of human serum ceruloplasmin at 3.1 angstrom: Nature of the copper centres.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60494	0.0	2908	3623	1.000	0.386	CUBN_HUMAN Cubilin OS=Homo sapiens OX=9606 GN=CUBN PE=1 SV=5
2	O70244	0.0	2107	3623	0.704	0.272	CUBN_RAT Cubilin OS=Rattus norvegicus OX=10116 GN=Cubn PE=1 SV=2
3	Q9JLB4	0.0	2095	3623	0.704	0.272	CUBN_MOUSE Cubilin OS=Mus musculus OX=10090 GN=Cubn PE=1 SV=3
4	Q9TU53	0.0	2401	3620	0.823	0.318	CUBN_CANLF Cubilin OS=Canis lupus familiaris OX=9615 GN=CUBN PE=1 SV=1
5	Q9W332	0.0	701	3750	0.344	0.129	CUBN_DROME Cubilin homolog OS=Drosophila melanogaster OX=7227 GN=Cubn PE=2 SV=3
6	Q9VTP0	4.61e-166	556	3613	0.318	0.123	Q9VTP0_DROME Cubulin 2 OS=Drosophila melanogaster OX=7227 GN=Cubn2 PE=4 SV=4
7	Q9Y6L7	2.94e-83	298	1015	0.146	0.201	TLL2_HUMAN Tolloid-like protein 2 OS=Homo sapiens OX=9606 GN=TLL2 PE=1 SV=1
8	O43897	2.80e-82	295	1013	0.142	0.196	TLL1_HUMAN Tolloid-like protein 1 OS=Homo sapiens OX=9606 GN=TLL1 PE=1 SV=1
9	Q9WVM6	3.55e-82	294	1012	0.141	0.196	TLL2_MOUSE Tolloid-like protein 2 OS=Mus musculus OX=10090 GN=Tll2 PE=1 SV=1
10	P13497	1.60e-81	292	986	0.144	0.204	BMP1_HUMAN Bone morphogenetic protein 1 OS=Homo sapiens OX=9606 GN=BMP1 PE=1 SV=2
11	F1M798	1.76e-81	292	990	0.144	0.203	F1M798_RAT Metalloendopeptidase OS=Rattus norvegicus OX=10116 GN=Bmp1 PE=4 SV=2
12	P98063	2.41e-81	291	991	0.144	0.203	BMP1_MOUSE Bone morphogenetic protein 1 OS=Mus musculus OX=10090 GN=Bmp1 PE=1 SV=2
13	Q62381	7.67e-81	290	1013	0.143	0.197	TLL1_MOUSE Tolloid-like protein 1 OS=Mus musculus OX=10090 GN=Tll1 PE=1 SV=1
14	Q8JI28	1.35e-79	286	1007	0.136	0.190	TLL1_XENLA Tolloid-like protein 1 OS=Xenopus laevis OX=8355 GN=tll1 PE=1 SV=1
15	O57460	8.65e-79	285	1022	0.139	0.190	TLL1_DANRE Dorsal-ventral patterning tolloid-like protein 1 OS=Danio rerio OX=7955 GN=tll1 PE=2 SV=1
16	F1REM3	1.84e-78	283	976	0.143	0.205	F1REM3_DANRE Metalloendopeptidase OS=Danio rerio OX=7955 GN=bmp1a PE=4 SV=2
17	Q2ABP1	2.07e-77	280	986	0.143	0.203	Q2ABP1_DANRE Metalloendopeptidase OS=Danio rerio OX=7955 GN=bmp1a PE=2 SV=1
18	P25723	1.27e-69	257	1067	0.127	0.167	TLD_DROME Dorsal-ventral patterning protein tolloid OS=Drosophila melanogaster OX=7227 GN=tld PE=2 SV=2
19	Q9VC47	3.25e-67	253	1464	0.136	0.130	TOK_DROME Protein tolkin OS=Drosophila melanogaster OX=7227 GN=tok PE=1 SV=1
20	Q60997	3.98e-52	204	2085	0.114	0.077	DMBT1_MOUSE Deleted in malignant brain tumors 1 protein OS=Mus musculus OX=10090 GN=Dmbt1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12662 cEGF	3.5	18.9	Complement Clr-like EGF-like
2	PF00431 CUB	3.4e-207	685.7	CUB domain
3	PF02408 CUB_2	1	20.6	CUB-like domain
4	PF00008 EGF	9.2e-26	101.1	EGF-like domain
5	PF07974 EGF_2	1	21.1	EGF-like domain
6	PF12947 EGF_3	3.2e-17	73.7	EGF domain
7	PF07645 EGF_CA	7.8e-20	82.1	Calcium-binding EGF domain
8	PF14670 FXa_inhibition	2.1e-06	39.2	Coagulation Factor Xa inhibitory site
9	PF12661 hEGF	8.8e-16	69.1	Human growth factor-like EGF

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000367064

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263816	0.999	Low-density lipoprotein receptor-related protein 2
2	9606.ENSP00000299155	0.999	Protein amnionless
3	9606.ENSP00000257248	0.998	Gastric intrinsic factor
4	9606.ENSP00000295897	0.987	Serum albumin
5	9606.ENSP00000236850	0.986	Apolipoprotein A-I
6	9606.ENSP00000421725	0.983	Vitamin D-binding protein
7	9606.ENSP00000264033	0.938	E3 ubiquitin-protein ligase CBL
8	9606.ENSP00000376911	0.914	Legumain
9	9606.ENSP00000363458	0.726	Low density lipoprotein receptor adapter protein 1
10	9606.ENSP00000215838	0.716	Transcobalamin-2
11	9606.ENSP00000257264	0.690	Transcobalamin-1
12	9606.ENSP00000365256	0.687	H(+)/Cl(-) exchange transporter 5
13	9606.ENSP00000254301	0.671	Galectin-3
14	9606.ENSP00000481728	0.671	ATP-binding cassette sub-family G member 4
15	9606.ENSP00000321797	0.667	Fibroblast growth factor 8
16	9606.ENSP00000243077	0.635	Prolow-density lipoprotein receptor-related protein 1
17	9606.ENSP00000301458	0.632	CD320 antigen
18	9606.ENSP00000278282	0.625	Uteroglobin
19	9606.ENSP00000346829	0.614	Protein wntless homolog
20	9606.ENSP00000441831	0.607	Fibronectin type-III domain-containing protein 3A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0038023	0.995	signaling receptor activity
GO:0042802	0.987	identical protein binding
GO:0038024	0.742	cargo receptor activity
GO:0046983	0.682	protein dimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006810	0.967	transport
GO:0006766	0.903	vitamin metabolic process
GO:0009987	0.882	cellular process
GO:0051180	0.875	vitamin transport
GO:0033013	0.851	tetrapyrrole metabolic process
GO:0071702	0.837	organic substance transport
GO:0006767	0.806	water-soluble vitamin metabolic process
GO:0071705	0.777	nitrogen compound transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0043231	0.985	intracellular membrane-bounded organelle
GO:0098590	0.982	plasma membrane region
GO:0031982	0.981	vesicle
GO:0005737	0.973	cytoplasm
GO:0045177	0.944	apical part of cell
GO:0012505	0.942	endomembrane system
GO:0031410	0.863	cytoplasmic vesicle
GO:0016324	0.773	apical plasma membrane
GO:0070013	0.759	intracellular organelle lumen
GO:0005576	0.758	extracellular region
GO:0042995	0.689	cell projection
GO:0120025	0.675	plasma membrane bounded cell projection
GO:0031253	0.632	cell projection membrane
GO:0032991	0.610	protein-containing complex
GO:0030139	0.387	endocytic vesicle
GO:0000323	0.310	lytic vacuole
GO:0005764	0.304	lysosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]