StarFunc result for job id O60502

User Input

>input (916 residues)
MVQKESQATLEERESELSSNPAASAGASLEPPAAPAPGEDNPAGAGGAAVAGAAGGARRF
LCGVVEGFYGRPWVMEQRKELFRRLQKWELNTYLYAPKDDYKHRMFWREMYSVEEAEQLM
TLISAAREYEIEFIYAISPGLDITFSNPKEVSTLKRKLDQVSQFGCRSFALLFDDIDHNM
CAADKEVFSSFAHAQVSITNEIYQYLGEPETFLFCPTEYCGTFCYPNVSQSPYLRTVGEK
LLPGIEVLWTGPKVVSKEIPVESIEEVSKIIKRAPVIWDNIHANDYDQKRLFLGPYKGRS
TELIPRLKGVLTNPNCEFEANYVAIHTLATWYKSNMNGVRKDVVMTDSEDSTVSIQIKLE
NEGSDEDIETDVLYSPQMALKLALTEWLQEFGVPHQYSSRQVAHSGAKASVVDGTPLVAA
PSLNATTVVTTVYQEPIMSQGAALSGEPTTLTKEEEKKQPDEEPMDMVVEKQEETDHKND
NQILSEIVEAKMAEELKPMDTDKESIAESKSPEMSMQEDCISDIAPMQTDEQTNKEQFVP
GPNEKPLYTAEPVTLEDLQLLADLFYLPYEHGPKGAQMLREFQWLRANSSVVSVNCKGKD
SEKIEEWRSRAAKFEEMCGLVMGMFTRLSNCANRTILYDMYSYVWDIKSIMSMVKSFVQW
LGCRSHSSAQFLIGDQEPWAFRGGLAGEFQRLLPIDGANDLFFQPPPLTPTSKVYTIRPY
FPKDEASVYKICREMYDDGVGLPFQSQPDLIGDKLVGGLLSLSLDYCFVLEDEDGICGYA
LGTVDVTPFIKKCKISWIPFMQEKYTKPNGDKELSEAEKIMLSFHEEQEVLPETFLANFP
SLIKMDIHKKVTDPSVAKSMMACLLSSLKANGSRGAFCEVRPDDKRILEFYSKLGCFEIA
KMEGFPKDVVILGRSL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60502	1.000	1.000	0.000	916	1.000	1.000	O60502.pdb.gz	OGA_HUMAN Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2
2	AFDB:Q9VDC9	0.705	0.635	3.744E-74	1019	0.388	0.348	Q9VDC9.pdb.gz	Q9VDC9_DROME O-GlcNAcase OS=Drosophila melanogaster OX=7227 GN=Oga PE=1 SV=1
3	PDB:6hkiA	0.471	0.868	4.812E-64	490	0.532	0.994	6hkiA.pdb.gz
4	AFDB:A8WFI7	0.659	0.691	5.233E-60	872	0.284	0.298	A8WFI7.pdb.gz	A8WFI7_CAEEL Protein O-GlcNAcase OS=Caenorhabditis elegans OX=6239 GN=oga-1 PE=1 SV=1
5	PDB:7ou6AAA	0.446	0.943	7.460E-60	430	0.466	0.993	7ou6AAA.pdb.gz	Bicyclic Picomolar OGA Inhibitors Enable Chemoproteomic Mapping of Its Endogenous Post-translational Modifications
6	AFDB:Q2CEE3	0.414	0.834	2.132E-32	447	0.159	0.327	Q2CEE3.pdb.gz	OGA_OCEGH Protein O-GlcNAcase OS=Oceanicola granulosus (strain ATCC BAA-861 / DSM 15982 / KCTC 12143 / HTCC2516) OX=314256 GN=OG2516_04129 PE=1 SV=1
7	PDB:7khsA	0.411	0.822	9.841E-31	449	0.159	0.325	7khsA.pdb.gz	Diazaspirononane Nonsaccharide Inhibitors of O-GlcNAcase (OGA) for the Treatment of Neurodegenerative Disorders.
8	PDB:7khsC	0.401	0.840	1.858E-28	427	0.159	0.342	7khsC.pdb.gz	Diazaspirononane Nonsaccharide Inhibitors of O-GlcNAcase (OGA) for the Treatment of Neurodegenerative Disorders.
9	AFDB:Q0TR53	0.373	0.343	5.932E-23	1001	0.127	0.116	Q0TR53.pdb.gz	OGA_CLOP1 O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
10	PDB:5fl1A	0.393	0.504	7.664E-22	703	0.142	0.185	5fl1A.pdb.gz	Analysis of transition state mimicry by tight binding aminothiazoline inhibitors provides insight into catalysis by humanO-GlcNAcase.
11	PDB:3vnlA	0.192	0.504	2.713E-5	291	0.034	0.107	3vnlA.pdb.gz	Crystal structures of D-psicose 3-epimerase from Clostridium cellulolyticum H10 and its complex with ketohexose sugars.
12	PDB:2hk1A	0.192	0.519	3.466E-5	289	0.033	0.104	2hk1A.pdb.gz	Crystal Structure of d-Psicose 3-epimerase from Agrobacterium tumefaciens and its Complex with True Substrate d-Fructose: A Pivotal Role of Metal in Catalysis, an Active Site for the Non-phosphorylated Substrate, and its Conformational Changes
13	PDB:2gjxA	0.216	0.376	5.386E-5	492	0.043	0.079	2gjxA.pdb.gz
14	PDB:6k35A	0.180	0.251	5.940E-5	640	0.033	0.047	6k35A.pdb.gz	NAG-thiazoline is a potent inhibitor of the Vibrio campbellii GH20 beta-N-Acetylglucosaminidase.
15	PDB:5c54A	0.187	0.472	6.880E-5	310	0.024	0.071	5c54A.pdb.gz
16	AFDB:Q4WEP7	0.197	0.203	3.260E-4	888	0.061	0.063	Q4WEP7.pdb.gz	CHIA1_ASPFU Endochitinase A1 OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=chiA1 PE=3 SV=1
17	AFDB:Q9VJ73	0.144	0.167	1.563E-3	774	0.080	0.094	Q9VJ73.pdb.gz	Q9VJ73_DROME Ada2a-containing complex component 2 OS=Drosophila melanogaster OX=7227 GN=Atac2 PE=1 SV=1
18	AFDB:Q9UHI6	0.091	0.098	1.055E-1	824	0.082	0.091	Q9UHI6.pdb.gz	DDX20_HUMAN Probable ATP-dependent RNA helicase DDX20 OS=Homo sapiens OX=9606 GN=DDX20 PE=1 SV=2
19	AFDB:Q38CF8	0.071	0.139	4.157E-1	345	0.052	0.139	Q38CF8.pdb.gz	Q38CF8_TRYB2 Leucine-rich repeat protein (LRRP) OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.7350 PE=4 SV=1
20	AFDB:F4K3G5	0.078	0.062	4.585E-1	1297	0.081	0.057	F4K3G5.pdb.gz	EDM2_ARATH Protein ENHANCED DOWNY MILDEW 2 OS=Arabidopsis thaliana OX=3702 GN=EDM2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60502	0.0	1905	916	1.000	1.000	OGA_HUMAN Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2
2	Q8VIJ5	0.0	1862	916	0.974	0.974	OGA_RAT Protein O-GlcNAcase OS=Rattus norvegicus OX=10116 GN=Oga PE=1 SV=1
3	Q9EQQ9	0.0	1864	916	0.973	0.973	OGA_MOUSE Protein O-GlcNAcase OS=Mus musculus OX=10090 GN=Oga PE=1 SV=2
4	Q9VDC9	1.25e-133	427	1019	0.216	0.194	Q9VDC9_DROME O-GlcNAcase OS=Drosophila melanogaster OX=7227 GN=Oga PE=1 SV=1
5	A8WFI7	2.74e-122	394	872	0.295	0.310	A8WFI7_CAEEL Protein O-GlcNAcase OS=Caenorhabditis elegans OX=6239 GN=oga-1 PE=1 SV=1
6	Q1WBU8	5.33e-122	392	854	0.295	0.316	Q1WBU8_CAEEL OGA-1b OS=Caenorhabditis elegans OX=6239 GN=oga-1 PE=1 SV=1
7	Q2CEE3	1.52e-70	243	447	0.123	0.253	OGA_OCEGH Protein O-GlcNAcase OS=Oceanicola granulosus (strain ATCC BAA-861 / DSM 15982 / KCTC 12143 / HTCC2516) OX=314256 GN=OG2516_04129 PE=1 SV=1
8	Q89ZI2	2.79e-44	174	737	0.109	0.136	OGA_BACTN O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
9	Q0TR53	1.77e-43	173	1001	0.108	0.099	OGA_CLOP1 O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
10	Q8XL08	3.62e-43	172	1001	0.108	0.099	OGA_CLOPE O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
11	Q961J2	1.01e-40	154	312	0.102	0.298	Q961J2_DROME GH20986p OS=Drosophila melanogaster OX=7227 GN=Oga PE=2 SV=1
12	P26831	2.34e-20	99.8	1628	0.083	0.047	NAGH_CLOPE Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
13	Q54BH4	0.64	36.2	575	0.027	0.043	Q54BH4_DICDI Spindle assembly checkpoint component MAD1 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0293620 PE=4 SV=1
14	P31224	0.78	36.2	1049	0.029	0.026	ACRB_ECOLI Multidrug efflux pump subunit AcrB OS=Escherichia coli (strain K12) OX=83333 GN=acrB PE=1 SV=1
15	Q57XP3	3.2	33.9	421	0.024	0.052	Q57XP3_TRYB2 DNA primase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.22O10.270 PE=3 SV=1
16	A0A1D8PND1	6.4	32.7	469	0.025	0.049	A0A1D8PND1_CANAL Phosphatidate cytidylyltransferase, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PTH1 PE=3 SV=1
17	Q9Y7R4	6.8	33.1	920	0.022	0.022	SET1_SCHPO Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=set1 PE=1 SV=1
18	E0SDG8	7.6	32.7	3326	0.019	0.005	CDIA_DICD3 Deoxyribonuclease CdiA OS=Dickeya dadantii (strain 3937) OX=198628 GN=cdiA PE=1 SV=1
19	P26641	7.7	32.3	437	0.041	0.087	EF1G_HUMAN Elongation factor 1-gamma OS=Homo sapiens OX=9606 GN=EEF1G PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07555 NAGidase	2.4e-78	275.0	beta-N-acetylglucosaminidase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354850

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362824	0.998	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
2	9606.ENSP00000313950	0.822	Aurora kinase B
3	9606.ENSP00000452780	0.806	Beta-2-microglobulin
4	9606.ENSP00000344844	0.803	Hepatitis A virus cellular receptor 1
5	9606.ENSP00000349687	0.795	Ganglioside GM2 activator
6	9606.ENSP00000253778	0.771	Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2
7	9606.ENSP00000349860	0.765	Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1
8	9606.ENSP00000295897	0.754	Serum albumin
9	9606.ENSP00000362108	0.747	Neutrophil gelatinase-associated lipocalin
10	9606.ENSP00000379680	0.739	Alpha-N-acetylgalactosaminidase
11	9606.ENSP00000381448	0.734	Cystatin-C
12	9606.ENSP00000479101	0.733	Ectoderm-neural cortex protein 1
13	9606.ENSP00000302728	0.732	Beta-glucuronidase
14	9606.ENSP00000269305	0.728	Cellular tumor antigen p53
15	9606.ENSP00000264914	0.725	Arylsulfatase B
16	9606.ENSP00000362888	0.676	2-aminoethanethiol dioxygenase
17	9606.ENSP00000373206	0.661	EGF domain-specific O-linked N-acetylglucosamine transferase
18	9606.ENSP00000295834	0.660	Fatty acid-binding protein, liver
19	9606.ENSP00000261416	0.655	Beta-hexosaminidase subunit beta
20	9606.ENSP00000359170	0.651	Protein DPCD

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004563	1.000	beta-N-acetylhexosaminidase activity
GO:0042802	0.998	identical protein binding
GO:0004415	0.991	hyalurononglucosaminidase activity
GO:0016231	0.989	beta-N-acetylglucosaminidase activity
GO:0140096	0.427	catalytic activity, acting on a protein

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.982	primary metabolic process
GO:0006040	0.959	amino sugar metabolic process
GO:0006807	0.954	nitrogen compound metabolic process
GO:0044237	0.940	cellular metabolic process
GO:1901564	0.890	organonitrogen compound metabolic process
GO:0043170	0.880	macromolecule metabolic process
GO:0065007	0.845	biological regulation
GO:0050789	0.805	regulation of biological process
GO:0019538	0.722	protein metabolic process
GO:0050794	0.589	regulation of cellular process
GO:1901071	0.503	glucosamine-containing compound metabolic process
GO:0009056	0.471	catabolic process
GO:0019222	0.447	regulation of metabolic process
GO:0060255	0.391	regulation of macromolecule metabolic process
GO:0050896	0.386	response to stimulus
GO:0080090	0.381	regulation of primary metabolic process
GO:0051171	0.381	regulation of nitrogen compound metabolic process
GO:0031323	0.380	regulation of cellular metabolic process
GO:0043412	0.355	macromolecule modification
GO:0036211	0.313	protein modification process
GO:0048518	0.306	positive regulation of biological process
GO:0048519	0.304	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0016020	0.995	membrane
GO:0005829	0.992	cytosol
GO:0005739	0.816	mitochondrion
GO:0070013	0.527	intracellular organelle lumen
GO:0071944	0.454	cell periphery
GO:0005886	0.444	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.2.1.52	1.000	beta-N-acetylhexosaminidase.
EC:3.2.1.35	0.991	hyaluronoglucosaminidase.

[back to server]