StarFunc result for job id O60504

User Input

>input (671 residues)
MQGPPRSLRAGLSLDDFIPGHLQSHIGSSSRGTRVPVIRNGGSNTLNFQFHDPAPRTVCN
GGYTPRRDASQHPDPAWYQTWPGPGSKPSASTKIPASQHTQNWSATWTKDSKRRDKRWVK
YEGIGPVDESGMPIAPRSSVDRPRDWYRRMFQQIHRKMPDLQLDWTFEEPPRDPRHLGAQ
QRPAHRPGPATSSSGRSWDHSEELPRSTFNYRPGAFSTVLQPSNQVLRRREKVDNVWTEE
SWNQFLQELETGQRPKKPLVDDPGEKPSQPIEVLLERELAELSAELDKDLRAIETRLPSP
KSSPAPRRAPEQRPPAGPASAWSSSYPHAPYLGSARSLSPHKMADGGSPFLGRRDFVYPS
STRDPSASNGGGSPARREEKKRKAARLKFDFQAQSPKELTLQKGDIVYIHKEVDKNWLEG
EHHGRLGIFPANYVEVLPADEIPKPIKPPTYQVLEYGEAVAQYTFKGDLEVELSFRKGEH
ICLIRKVNENWYEGRITGTGRQGIFPASYVQVSREPRLRLCDDGPQLPTSPRLTAAARSA
RHPSSPSALRSPADPIDLGGQTSPRRTGFSFPTQEPRPQTQNLGTPGPALSHSRGPSHPL
DLGTSSPNTSQIHWTPYRAMYQYRPQNEDELELREGDRVDVMQQCDDGWFVGVSRRTQKF
GTFPGNYVAPV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60504	1.000	1.000	2.049E-103	671	1.000	1.000	O60504.pdb.gz	VINEX_HUMAN Vinexin OS=Homo sapiens OX=9606 GN=SORBS3 PE=1 SV=2
2	AFDB:A0A0U1RQE4	0.130	0.095	9.976E-17	1047	0.194	0.124	A0A0U1RQE4.pdb.gz	A0A0U1RQE4_HUMAN SH3 domain containing 19 OS=Homo sapiens OX=9606 GN=SH3D19 PE=1 SV=1
3	AFDB:A0A494C1M0	0.134	0.102	5.146E-15	1011	0.191	0.127	A0A494C1M0.pdb.gz	A0A494C1M0_HUMAN SH3 domain containing 19 OS=Homo sapiens OX=9606 GN=SH3D19 PE=1 SV=1
4	AFDB:A9P3U3	0.102	0.091	2.257E-11	774	0.152	0.132	A9P3U3.pdb.gz	A9P3U3_EMEND AbpA OS=Emericella nidulans OX=162425 GN=abpA PE=4 SV=1
5	PDB:2lqnA	0.100	0.193	3.082E-8	303	0.092	0.205	2lqnA.pdb.gz
6	PDB:1griA	0.091	0.250	1.235E-7	211	0.066	0.209	1griA.pdb.gz
7	AFDB:O15117	0.096	0.085	3.552E-7	783	0.170	0.146	O15117.pdb.gz	FYB1_HUMAN FYN-binding protein 1 OS=Homo sapiens OX=9606 GN=FYB1 PE=1 SV=2
8	PDB:2eyzA	0.088	0.189	2.345E-6	304	0.061	0.135	2eyzA.pdb.gz
9	AFDB:Q9W0S0	0.090	0.063	3.099E-6	1026	0.130	0.085	Q9W0S0.pdb.gz	Q9W0S0_DROME LP23332p OS=Drosophila melanogaster OX=7227 GN=RhoGEF3 PE=2 SV=2
10	PDB:2dybA	0.087	0.191	3.018E-5	298	0.039	0.087	2dybA.pdb.gz
11	AFDB:Q13387	0.084	0.068	5.882E-5	824	0.182	0.148	Q13387.pdb.gz	JIP2_HUMAN C-Jun-amino-terminal kinase-interacting protein 2 OS=Homo sapiens OX=9606 GN=MAPK8IP2 PE=1 SV=2
12	AFDB:A0A0S3NTN0	0.085	0.073	7.765E-5	784	0.151	0.129	A0A0S3NTN0.pdb.gz
13	PDB:3qwyA	0.105	0.334	1.024E-4	170	0.045	0.176	3qwyA.pdb.gz
14	PDB:1k9aB	0.084	0.126	1.210E-4	441	0.033	0.050	1k9aB.pdb.gz
15	PDB:3ehqA	0.081	0.288	2.632E-4	182	0.033	0.121	3ehqA.pdb.gz
16	PDB:6x5hA	0.087	0.124	3.883E-4	467	0.024	0.034	6x5hA.pdb.gz	Characterizing human alpha-1,6-fucosyltransferase (FUT8) substrate specificity and structural similarities with related fucosyltransferases.
17	PDB:2h8hA	0.081	0.121	6.056E-4	445	0.027	0.040	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
18	PDB:1k0xA	0.084	0.460	1.116E-3	108	0.021	0.130	1k0xA.pdb.gz
19	AFDB:Q6BCL1	0.086	0.086	2.647E-2	675	0.156	0.156	Q6BCL1.pdb.gz	PRAM_MOUSE PML-RARA-regulated adapter molecule 1 OS=Mus musculus OX=10090 GN=Pram1 PE=1 SV=2
20	AFDB:W5U9R6	0.074	0.061	7.193E-2	879	0.149	0.114	W5U9R6.pdb.gz	W5U9R6_ICTPU Nuclear factor of activated T-cells, cytoplasmic 1 OS=Ictalurus punctatus OX=7998 GN=NFATC1 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60504	0.0	1369	671	1.000	1.000	VINEX_HUMAN Vinexin OS=Homo sapiens OX=9606 GN=SORBS3 PE=1 SV=2
2	Q9R1Z8	0.0	1077	733	0.815	0.746	VINEX_MOUSE Vinexin OS=Mus musculus OX=10090 GN=Sorbs3 PE=1 SV=1
3	Q62417	6.72e-77	270	1290	0.215	0.112	SRBS1_MOUSE Sorbin and SH3 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Sorbs1 PE=1 SV=2
4	Q3UTJ2	1.74e-62	228	1180	0.210	0.119	SRBS2_MOUSE Sorbin and SH3 domain-containing protein 2 OS=Mus musculus OX=10090 GN=Sorbs2 PE=1 SV=2
5	O94875	2.03e-59	218	1100	0.186	0.114	SRBS2_HUMAN Sorbin and SH3 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SORBS2 PE=1 SV=3
6	O35413	6.00e-59	217	1196	0.209	0.117	SRBS2_RAT Sorbin and SH3 domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Sorbs2 PE=1 SV=2
7	Q966U7	7.11e-59	202	313	0.179	0.383	Q966U7_DROME CAP, isoform E OS=Drosophila melanogaster OX=7227 GN=CAP PE=2 SV=1
8	Q8IGB7	2.79e-58	202	350	0.180	0.346	Q8IGB7_DROME RH64582p (Fragment) OS=Drosophila melanogaster OX=7227 GN=CAP PE=2 SV=1
9	Q7K1M7	9.46e-57	202	500	0.179	0.240	Q7K1M7_DROME CAP, isoform G OS=Drosophila melanogaster OX=7227 GN=CAP PE=2 SV=1
10	D3DMM3	1.94e-56	202	554	0.179	0.217	D3DMM3_DROME CAP, isoform S OS=Drosophila melanogaster OX=7227 GN=CAP PE=2 SV=1
11	A1Z870	3.05e-56	202	565	0.179	0.212	A1Z870_DROME CAP, isoform J OS=Drosophila melanogaster OX=7227 GN=CAP PE=4 SV=1
12	A1Z872	8.84e-56	200	527	0.179	0.228	A1Z872_DROME CAP, isoform D OS=Drosophila melanogaster OX=7227 GN=CAP PE=4 SV=1
13	Q966U8	8.93e-56	200	527	0.174	0.222	Q966U8_DROME DCAPL4 OS=Drosophila melanogaster OX=7227 GN=CAP PE=2 SV=1
14	A1Z866	9.85e-56	202	639	0.179	0.188	A1Z866_DROME CAP, isoform I OS=Drosophila melanogaster OX=7227 GN=CAP PE=1 SV=1
15	Q8IGN4	1.18e-55	202	647	0.179	0.185	Q8IGN4_DROME RE58362p (Fragment) OS=Drosophila melanogaster OX=7227 GN=CAP PE=2 SV=1
16	Q86P80	2.01e-55	201	630	0.179	0.190	Q86P80_DROME CAP, isoform K OS=Drosophila melanogaster OX=7227 GN=CAP PE=2 SV=1
17	A0A0B4K7W2	3.34e-55	202	674	0.179	0.178	A0A0B4K7W2_DROME CAP, isoform U OS=Drosophila melanogaster OX=7227 GN=CAP PE=4 SV=1
18	B7YZD8	2.16e-54	204	2412	0.179	0.050	B7YZD8_DROME CAP, isoform Q OS=Drosophila melanogaster OX=7227 GN=CAP PE=4 SV=2
19	A0A0B4KEH7	2.22e-54	204	2409	0.179	0.050	A0A0B4KEH7_DROME CAP, isoform Y OS=Drosophila melanogaster OX=7227 GN=CAP PE=4 SV=1
20	A1Z867	2.40e-54	204	2376	0.179	0.051	A1Z867_DROME CAP, isoform A OS=Drosophila melanogaster OX=7227 GN=CAP PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00018 SH3_1	2.8e-34	127.8	SH3 domain
2	PF07653 SH3_2	1e-25	100.6	Variant SH3 domain
3	PF14604 SH3_9	8.3e-38	139.4	Variant SH3 domain
4	PF02208 Sorb	8.8e-14	62.1	Sorbin homologous domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000240123

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000211998	0.998	Vinculin
2	9606.ENSP00000252542	0.907	Scaffold attachment factor B2
3	9606.ENSP00000267257	0.903	Paxillin
4	9606.ENSP00000360293	0.898	Sorbin and SH3 domain-containing protein 1
5	9606.ENSP00000272430	0.851	Rhotekin
6	9606.ENSP00000316029	0.851	Talin-1
7	9606.ENSP00000361467	0.811	Disks large homolog 5
8	9606.ENSP00000296181	0.810	Integrin beta-5
9	9606.ENSP00000282588	0.806	Integrin alpha-1
10	9606.ENSP00000298229	0.803	Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2
11	9606.ENSP00000264033	0.768	E3 ubiquitin-protein ligase CBL
12	9606.ENSP00000467423	0.750	Scaffold attachment factor B1
13	9606.ENSP00000353452	0.704	Myosin light chain kinase, smooth muscle
14	9606.ENSP00000314067	0.699	Serine/threonine-protein kinase PAK 2
15	9606.ENSP00000302297	0.688	Leucine-rich repeat LGI family member 3
16	9606.ENSP00000265085	0.683	Cytoplasmic polyadenylation element-binding protein 4
17	9606.ENSP00000312634	0.661	PDZ and LIM domain protein 2
18	9606.ENSP00000482229	0.654	Suppressor of cytokine signaling 7
19	9606.ENSP00000245932	0.648	Vasodilator-stimulated phosphoprotein
20	9606.ENSP00000279022	0.643	Myosin regulatory light polypeptide 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0017166	0.988	vinculin binding
GO:0005198	0.932	structural molecule activity
GO:0005200	0.916	structural constituent of cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050794	0.992	regulation of cellular process
GO:0048522	0.981	positive regulation of cellular process
GO:0007155	0.914	cell adhesion
GO:0051493	0.859	regulation of cytoskeleton organization
GO:1902903	0.849	regulation of supramolecular fiber organization
GO:0032970	0.845	regulation of actin filament-based process
GO:0032956	0.838	regulation of actin cytoskeleton organization
GO:0044087	0.833	regulation of cellular component biogenesis
GO:0051130	0.813	positive regulation of cellular component organization
GO:0110053	0.762	regulation of actin filament organization
GO:1902905	0.673	positive regulation of supramolecular fiber organization
GO:0110020	0.670	regulation of actomyosin structure organization
GO:0032231	0.670	regulation of actin filament bundle assembly
GO:0051495	0.654	positive regulation of cytoskeleton organization
GO:0050896	0.640	response to stimulus
GO:0044089	0.615	positive regulation of cellular component biogenesis
GO:0032233	0.538	positive regulation of actin filament bundle assembly
GO:0051492	0.434	regulation of stress fiber assembly
GO:0051716	0.388	cellular response to stimulus
GO:0007154	0.365	cell communication
GO:0007165	0.357	signal transduction
GO:0071840	0.326	cellular component organization or biogenesis
GO:0016043	0.324	cellular component organization
GO:0048519	0.319	negative regulation of biological process
GO:0051496	0.312	positive regulation of stress fiber assembly
GO:0048523	0.301	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0030055	0.998	cell-substrate junction
GO:0005829	0.991	cytosol
GO:0005925	0.991	focal adhesion
GO:0043229	0.973	intracellular organelle
GO:0043227	0.958	membrane-bounded organelle
GO:0005634	0.910	nucleus
GO:0016020	0.877	membrane
GO:0031974	0.336	membrane-enclosed lumen
GO:0043233	0.329	organelle lumen
GO:0070013	0.323	intracellular organelle lumen
GO:0071944	0.301	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]