StarFunc result for job id O60506

User Input

>input (623 residues)
MATEHVNGNGTEEPMDTTSAVIHSENFQTLLDAGLPQKVAEKLDEIYVAGLVAHSDLDER
AIEALKEFNEDGALAVLQQFKDSDLSHVQNKSAFLCGVMKTYRQREKQGTKVADSSKGPD
EAKIKALLERTGYTLDVTTGQRKYGGPPPDSVYSGQQPSVGTEIFVGKIPRDLFEDELVP
LFEKAGPIWDLRLMMDPLTGLNRGYAFVTFCTKEAAQEAVKLYNNHEIRSGKHIGVCISV
ANNRLFVGSIPKSKTKEQILEEFSKVTEGLTDVILYHQPDDKKKNRGFCFLEYEDHKTAA
QARRRLMSGKVKVWGNVGTVEWADPIEDPDPEVMAKVKVLFVRNLANTVTEEILEKAFSQ
FGKLERVKKLKDYAFIHFDERDGAVKAMEEMNGKDLEGENIEIVFAKPPDQKRKERKAQR
QAAKNQMYDDYYYYGPPHMPPPTRGRGRGGRGGYGYPPDYYGYEDYYDYYGYDYHNYRGG
YEDPYYGYEDFQVGARGRGGRGARGAAPSRGRGAAPPRGRAGYSQRGGPGSARGVRGARG
GAQQQRGRGVRGARGGRGGNVGGKRKADGYNQPDSKRRQTNNQNWGSQPIAQQPLQGGDH
SGNYGYKSENQEFYQDTFGQQWK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60506	1.000	1.000	0.000	623	1.000	1.000	O60506.pdb.gz	HNRPQ_HUMAN Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens OX=9606 GN=SYNCRIP PE=1 SV=2
2	AFDB:Q8IN47	0.616	0.677	4.540E-65	563	0.433	0.480	Q8IN47.pdb.gz	Q8IN47_DROME Syncrip, isoform A OS=Drosophila melanogaster OX=7227 GN=Syp PE=1 SV=2
3	AFDB:Q9ASP6	0.283	0.341	5.161E-28	495	0.196	0.246	Q9ASP6.pdb.gz	HNRPQ_ARATH Heterogeneous nuclear ribonucleoprotein Q OS=Arabidopsis thaliana OX=3702 GN=LIF2 PE=1 SV=1
4	PDB:5vsuA	0.140	0.211	7.395E-15	387	0.079	0.127	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
5	AFDB:B3DH54	0.188	0.171	4.335E-14	708	0.165	0.145	B3DH54.pdb.gz
6	AFDB:O43719	0.122	0.101	2.624E-13	755	0.136	0.113	O43719.pdb.gz	HTSF1_HUMAN HIV Tat-specific factor 1 OS=Homo sapiens OX=9606 GN=HTATSF1 PE=1 SV=1
7	AFDB:P92966	0.159	0.250	8.384E-13	356	0.120	0.211	P92966.pdb.gz	SRS41_ARATH Serine/arginine-rich splicing factor RS41 OS=Arabidopsis thaliana OX=3702 GN=RS41 PE=1 SV=2
8	PDB:6r5kH	0.123	0.176	7.426E-12	394	0.116	0.183	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
9	AFDB:Q8W4I9	0.123	0.095	1.019E-11	915	0.162	0.110	Q8W4I9.pdb.gz	AML1_ARATH Protein MEI2-like 1 OS=Arabidopsis thaliana OX=3702 GN=ML1 PE=1 SV=1
10	AFDB:Q8VWF5	0.137	0.115	4.889E-11	800	0.116	0.090	Q8VWF5.pdb.gz	AML5_ARATH Protein MEI2-like 5 OS=Arabidopsis thaliana OX=3702 GN=ML5 PE=1 SV=1
11	AFDB:Q9LYN7	0.117	0.090	6.927E-11	907	0.116	0.079	Q9LYN7.pdb.gz	AML4_ARATH Protein MEI2-like 4 OS=Arabidopsis thaliana OX=3702 GN=ML4 PE=2 SV=1
12	PDB:5lsbA	0.119	0.392	1.279E-10	176	0.063	0.222	5lsbA.pdb.gz
13	PDB:7oqcF	0.132	0.282	1.355E-10	267	0.063	0.146	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
14	AFDB:O61646	0.127	0.150	1.562E-10	513	0.128	0.156	O61646.pdb.gz	O61646_DROME Splicing factor SRp54 OS=Drosophila melanogaster OX=7227 GN=Srp54 PE=2 SV=3
15	PDB:6y53o	0.121	0.452	1.232E-9	160	0.080	0.312	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
16	PDB:7evoD	0.121	0.369	3.936E-9	200	0.064	0.200	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
17	PDB:6y5qq	0.108	0.359	5.262E-9	178	0.066	0.230	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
18	PDB:6ff7X	0.119	0.378	6.529E-7	171	0.058	0.211	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
19	PDB:5yzg1	0.124	0.311	1.654E-6	243	0.059	0.152	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
20	PDB:3lqvB	0.128	0.625	2.632E-6	115	0.035	0.191	3lqvB.pdb.gz	Branch Recognition by SF3b14

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F7B5B5	0.0	684	531	0.693	0.814	F7B5B5_MOUSE Heterogeneous nuclear ribonucleoprotein R OS=Mus musculus OX=10090 GN=Hnrnpr PE=1 SV=1
2	O43390	0.0	735	633	0.575	0.566	HNRPR_HUMAN Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens OX=9606 GN=HNRNPR PE=1 SV=1
3	O60506	0.0	1283	623	1.000	1.000	HNRPQ_HUMAN Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens OX=9606 GN=SYNCRIP PE=1 SV=2
4	Q3U8W9	0.0	838	632	0.806	0.794	Q3U8W9_MOUSE RRM domain-containing protein OS=Mus musculus OX=10090 GN=Hnrnpr PE=2 SV=1
5	Q3UKV5	0.0	773	610	0.761	0.777	Q3UKV5_MOUSE RRM domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Hnrnpr PE=2 SV=1
6	Q3UMT8	0.0	829	632	0.806	0.794	Q3UMT8_MOUSE RRM domain-containing protein OS=Mus musculus OX=10090 GN=Hnrnpr PE=2 SV=1
7	Q3UZI0	0.0	773	604	0.761	0.785	Q3UZI0_MOUSE RRM domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Hnrnpr PE=2 SV=1
8	Q566E4	0.0	829	632	0.807	0.796	Q566E4_RAT Heterogeneous nuclear ribonucleoprotein R OS=Rattus norvegicus OX=10116 GN=Hnrnpr PE=1 SV=1
9	Q59GL1	0.0	1029	534	0.803	0.936	Q59GL1_HUMAN Synaptotagmin binding, cytoplasmic RNA interacting protein variant (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
10	Q7TMK9	0.0	1281	623	0.997	0.997	HNRPQ_MOUSE Heterogeneous nuclear ribonucleoprotein Q OS=Mus musculus OX=10090 GN=Syncrip PE=1 SV=2
11	Q7TP47	0.0	1000	533	0.774	0.904	HNRPQ_RAT Heterogeneous nuclear ribonucleoprotein Q OS=Rattus norvegicus OX=10116 GN=Syncrip PE=2 SV=1
12	Q8VHM5	0.0	829	632	0.807	0.796	Q8VHM5_MOUSE Heterogeneous nuclear ribonucleoprotein R OS=Mus musculus OX=10090 GN=Hnrnpr PE=1 SV=1
13	Q99KG1	0.0	774	601	0.761	0.789	Q99KG1_MOUSE Hnrpr protein (Fragment) OS=Mus musculus OX=10090 GN=Hnrnpr PE=2 SV=1
14	Q9CT37	0.0	649	381	0.504	0.824	Q9CT37_MOUSE RRM domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Hnrnpr PE=2 SV=3
15	A0A0B4KHI4	2.27e-176	521	761	0.510	0.418	A0A0B4KHI4_DROME Syncrip, isoform Q OS=Drosophila melanogaster OX=7227 GN=Syp PE=1 SV=1
16	A0A0B4KGK8	5.28e-176	513	569	0.400	0.438	A0A0B4KGK8_DROME Syncrip, isoform R OS=Drosophila melanogaster OX=7227 GN=Syp PE=1 SV=1
17	A8JR54	6.55e-176	511	534	0.400	0.466	A8JR54_DROME Syncrip, isoform H OS=Drosophila melanogaster OX=7227 GN=Syp PE=1 SV=1
18	Q7KSA0	6.94e-176	518	711	0.512	0.449	Q7KSA0_DROME Syncrip, isoform B OS=Drosophila melanogaster OX=7227 GN=Syp PE=1 SV=1
19	A0A0B4KHH8	7.34e-176	519	753	0.510	0.422	A0A0B4KHH8_DROME Syncrip, isoform K OS=Drosophila melanogaster OX=7227 GN=Syp PE=1 SV=1
20	A4V364	1.03e-175	511	529	0.400	0.471	A4V364_DROME Syncrip, isoform F OS=Drosophila melanogaster OX=7227 GN=Syp PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04847 Calcipressin	56	14.9	Calcipressin
2	PF18360 hnRNP_Q_AcD	1.9e-29	112.9	Heterogeneous nuclear ribonucleoprotein Q acidic domain
3	PF14703 PHM7_cyt	1.4e+02	14.1	Cytosolic domain of 10TM putative phosphate transporter
4	PF00076 RRM_1	6.8e-40	146.1	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
5	PF13893 RRM_5	0.017	26.2	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
6	PF16367 RRM_7	0.0022	29.4	RNA recognition motif
7	PF16842 RRM_occluded	25	16.2	Occluded RNA-recognition motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 30611.ENSOGAP00000001535

Rank	PPI partner	STRING score	Description
1	30611.ENSOGAP00000011948	0.976	Heterogeneous nuclear ribonucleoprotein L
2	30611.ENSOGAP00000006688	0.969	annotation not available
3	30611.ENSOGAP00000016559	0.969	Uncharacterized protein
4	30611.ENSOGAP00000017222	0.969	annotation not available
5	30611.ENSOGAP00000020655	0.960	Serine/arginine-rich splicing factor 1
6	30611.ENSOGAP00000012559	0.956	Heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A)
7	30611.ENSOGAP00000015795	0.953	Sjogren syndrome antigen B (autoantigen La)
8	30611.ENSOGAP00000018342	0.941	Uncharacterized protein
9	30611.ENSOGAP00000019748	0.931	Heterogeneous nuclear ribonucleoprotein R
10	30611.ENSOGAP00000008229	0.930	annotation not available
11	30611.ENSOGAP00000004733	0.927	glutamyl-prolyl-tRNA synthetase
12	30611.ENSOGAP00000007193	0.925	Polypyrimidine tract binding protein 1
13	30611.ENSOGAP00000015830	0.925	Uncharacterized protein
14	30611.ENSOGAP00000013745	0.918	Heterogeneous nuclear ribonucleoprotein A2/B1
15	30611.ENSOGAP00000001368	0.917	DEAD (Asp-Glu-Ala-Asp) box helicase 17
16	30611.ENSOGAP00000003631	0.898	Heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa)
17	30611.ENSOGAP00000004817	0.886	Transformer 2 beta homolog (Drosophila)
18	30611.ENSOGAP00000015564	0.884	Heterogeneous nuclear ribonucleoprotein H2 (H')
19	30611.ENSOGAP00000011107	0.874	Aly/REF export factor
20	30611.ENSOGAP00000017328	0.865	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0005515	0.999	protein binding
GO:0003729	0.967	mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0071704	0.988	organic substance metabolic process
GO:0044238	0.985	primary metabolic process
GO:0044237	0.985	cellular metabolic process
GO:0080090	0.985	regulation of primary metabolic process
GO:0051171	0.985	regulation of nitrogen compound metabolic process
GO:0031323	0.984	regulation of cellular metabolic process
GO:0060255	0.983	regulation of macromolecule metabolic process
GO:0006807	0.974	nitrogen compound metabolic process
GO:0008380	0.960	RNA splicing
GO:0010608	0.953	post-transcriptional regulation of gene expression
GO:0051246	0.929	regulation of protein metabolic process
GO:0048519	0.903	negative regulation of biological process
GO:0006417	0.900	regulation of translation
GO:0048518	0.889	positive regulation of biological process
GO:0048523	0.886	negative regulation of cellular process
GO:1903311	0.876	regulation of mRNA metabolic process
GO:0016071	0.865	mRNA metabolic process
GO:0009894	0.852	regulation of catabolic process
GO:0009893	0.825	positive regulation of metabolic process
GO:0009892	0.799	negative regulation of metabolic process
GO:0031329	0.798	regulation of cellular catabolic process
GO:0051172	0.793	negative regulation of nitrogen compound metabolic process
GO:0010604	0.777	positive regulation of macromolecule metabolic process
GO:0006397	0.754	mRNA processing
GO:0010605	0.752	negative regulation of macromolecule metabolic process
GO:0031324	0.733	negative regulation of cellular metabolic process
GO:0061013	0.727	regulation of mRNA catabolic process
GO:0048522	0.723	positive regulation of cellular process
GO:0065008	0.710	regulation of biological quality
GO:0000375	0.707	RNA splicing, via transesterification reactions
GO:0010628	0.696	positive regulation of gene expression
GO:0043487	0.686	regulation of RNA stability
GO:0051173	0.671	positive regulation of nitrogen compound metabolic process
GO:0031325	0.669	positive regulation of cellular metabolic process
GO:0043488	0.663	regulation of mRNA stability
GO:1903312	0.663	negative regulation of mRNA metabolic process
GO:0045935	0.629	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.613	positive regulation of RNA metabolic process
GO:0010629	0.603	negative regulation of gene expression
GO:0000377	0.535	RNA splicing, via transesterification reactions with bulged adenosine as nucleophile
GO:0010558	0.533	negative regulation of macromolecule biosynthetic process
GO:0000398	0.533	mRNA splicing, via spliceosome
GO:0051248	0.532	negative regulation of protein metabolic process
GO:0031327	0.532	negative regulation of cellular biosynthetic process
GO:0017148	0.505	negative regulation of translation
GO:0050896	0.409	response to stimulus
GO:0071840	0.366	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0032991	0.993	protein-containing complex
GO:1990904	0.933	ribonucleoprotein complex
GO:0005829	0.878	cytosol
GO:0140513	0.813	nuclear protein-containing complex
GO:0016020	0.770	membrane
GO:0043233	0.704	organelle lumen
GO:0070013	0.692	intracellular organelle lumen
GO:0031981	0.435	nuclear lumen
GO:0005681	0.420	spliceosomal complex
GO:0005654	0.395	nucleoplasm
GO:0106002	0.382	mCRD-mediated mRNA stability complex
GO:0043232	0.380	intracellular non-membrane-bounded organelle
GO:0070937	0.373	CRD-mediated mRNA stability complex
GO:0071013	0.373	catalytic step 2 spliceosome
GO:0097452	0.370	GAIT complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]