StarFunc result for job id O60512

User Input

>input (393 residues)
MLRRLLERPCTLALLVGSQLAVMMYLSLGGFRSLSALFGRDQGPTFDYSHPRDVYSNLSH
LPGAPGGPPAPQGLPYCPERSPLLVGPVSVSFSPVPSLAEIVERNPRVEPGGRYRPAGCE
PRSRTAIIVPHRAREHHLRLLLYHLHPFLQRQQLAYGIYVIHQAGNGTFNRAKLLNVGVR
EALRDEEWDCLFLHDVDLLPENDHNLYVCDPRGPRHVAVAMNKFGYSLPYPQYFGGVSAL
TPDQYLKMNGFPNEYWGWGGEDDDIATRVRLAGMKISRPPTSVGHYKMVKHRGDKGNEEN
PHRFDLLVRTQNSWTQDGMNSLTYQLLARELGPLYTNITADIGTDPRGPRAPSGPRYPPG
SSQAFRQEMLQRRPPARPGPLSTANHTALRGSH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A384NY44	0.863	0.863	2.350E-82	393	1.000	1.000	A0A384NY44.pdb.gz	A0A384NY44_HUMAN Beta-1,4-galactosyltransferase OS=Homo sapiens OX=9606 PE=2 SV=1
2	AFDB:O60909	0.695	0.733	4.333E-46	372	0.455	0.481	O60909.pdb.gz	B4GT2_HUMAN Beta-1,4-galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=B4GALT2 PE=1 SV=1
3	AFDB:P08037	0.682	0.667	9.667E-46	402	0.461	0.450	P08037.pdb.gz	B4GT1_BOVIN Beta-1,4-galactosyltransferase 1 OS=Bos taurus OX=9913 GN=B4GALT1 PE=1 SV=3
4	AFDB:P15535	0.681	0.671	1.009E-44	399	0.448	0.441	P15535.pdb.gz	B4GT1_MOUSE Beta-1,4-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B4galt1 PE=1 SV=1
5	AFDB:B2RAZ5	0.681	0.778	7.270E-44	344	0.399	0.456	B2RAZ5.pdb.gz	B2RAZ5_HUMAN Beta-1,4-galactosyltransferase OS=Homo sapiens OX=9606 GN=B4GALT4 PE=2 SV=1
6	AFDB:P15291	0.683	0.675	7.270E-44	398	0.455	0.450	P15291.pdb.gz	B4GT1_HUMAN Beta-1,4-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=B4GALT1 PE=1 SV=5
7	AFDB:Q9GUM2	0.683	0.701	6.999E-42	383	0.369	0.379	Q9GUM2.pdb.gz	BRE4_CAEEL Beta-1,4-N-acetylgalactosaminyltransferase bre-4 OS=Caenorhabditis elegans OX=6239 GN=bre-4 PE=1 SV=1
8	AFDB:Q3YL68	0.655	0.675	8.303E-38	381	0.349	0.360	Q3YL68.pdb.gz	B4GT5_DANRE Beta-1,4-galactosyltransferase 5 OS=Danio rerio OX=7955 GN=b4galt5 PE=2 SV=2
9	AFDB:Q7KN92	0.668	0.652	1.933E-36	403	0.318	0.310	Q7KN92.pdb.gz	Q7KN92_DROME Beta1,4-N-acetylgalactosaminyltransferase A OS=Drosophila melanogaster OX=7227 GN=beta4GalNAcTA PE=2 SV=1
10	AFDB:F1QGG1	0.662	0.681	3.811E-36	381	0.336	0.346	F1QGG1.pdb.gz
11	PDB:6pxuB	0.322	0.246	2.639E-6	532	0.122	0.090	6pxuB.pdb.gz	The structure of the colorectal cancer-associated enzyme GalNAc-T12 reveals how nonconserved residues dictate its function.
12	PDB:4d0tA	0.335	0.273	3.526E-5	496	0.074	0.058	4d0tA.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N-Acetylgalactosaminyltransferase 2.
13	PDB:6h0bB	0.362	0.281	8.366E-5	521	0.081	0.061	6h0bB.pdb.gz	Structural and Mechanistic Insights into the Catalytic-Domain-Mediated Short-Range Glycosylation Preferences of GalNAc-T4.
14	PDB:4d11C	0.283	0.258	1.458E-4	436	0.079	0.071	4d11C.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N- Acetylgalactosaminyltransferase 2.
15	PDB:4fixA	0.307	0.199	1.650E-4	629	0.071	0.045	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.
16	PDB:2d7iA	0.292	0.222	2.389E-4	536	0.089	0.065	2d7iA.pdb.gz	Structural basis of carbohydrate transfer activity by human UDP-GalNAc: polypeptide alpha-N-acetylgalactosaminyltransferase (pp-GalNAc-T10)
17	PDB:6iwqA	0.372	0.278	4.710E-4	546	0.127	0.092	6iwqA.pdb.gz	Structural basis of carbohydrate transfer activity of UDP-GalNAc: Polypeptide N-acetylgalactosaminyltransferase 7.
18	PDB:4decA	0.300	0.390	5.562E-3	284	0.076	0.106	4decA.pdb.gz	Mechanistic insights into the retaining glucosyl-3-phosphoglycerate synthase from mycobacteria.
19	PDB:4hg6A	0.290	0.165	6.693E-3	747	0.094	0.050	4hg6A.pdb.gz	Crystallographic snapshot of cellulose synthesis and membrane translocation.
20	PDB:5mlzA	0.290	0.318	7.572E-3	355	0.064	0.070	5mlzA.pdb.gz	Structural basis for dolichylphosphate mannose biosynthesis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A384NY44	0.0	803	393	1.000	1.000	A0A384NY44_HUMAN Beta-1,4-galactosyltransferase OS=Homo sapiens OX=9606 PE=2 SV=1
2	O60512	0.0	803	393	1.000	1.000	B4GT3_HUMAN Beta-1,4-galactosyltransferase 3 OS=Homo sapiens OX=9606 GN=B4GALT3 PE=1 SV=2
3	P08037	3.65e-112	335	402	0.410	0.400	B4GT1_BOVIN Beta-1,4-galactosyltransferase 1 OS=Bos taurus OX=9913 GN=B4GALT1 PE=1 SV=3
4	Q99PC2	5.07e-111	332	393	0.394	0.394	Q99PC2_CRIGR Beta-1,4-galactosyltransferase OS=Cricetulus griseus OX=10029 GN=beta4GalT-1 PE=2 SV=1
5	P15291	1.53e-110	331	398	0.407	0.402	B4GT1_HUMAN Beta-1,4-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=B4GALT1 PE=1 SV=5
6	P15535	1.82e-109	328	399	0.407	0.401	B4GT1_MOUSE Beta-1,4-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B4galt1 PE=1 SV=1
7	O60909	6.89e-103	311	372	0.402	0.425	B4GT2_HUMAN Beta-1,4-galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=B4GALT2 PE=1 SV=1
8	B2RAZ5	8.19e-103	309	344	0.387	0.442	B2RAZ5_HUMAN Beta-1,4-galactosyltransferase OS=Homo sapiens OX=9606 GN=B4GALT4 PE=2 SV=1
9	O60513	8.19e-103	309	344	0.387	0.442	B4GT4_HUMAN Beta-1,4-galactosyltransferase 4 OS=Homo sapiens OX=9606 GN=B4GALT4 PE=1 SV=1
10	Q9Z2Y2	8.86e-103	310	369	0.405	0.431	B4GT2_MOUSE Beta-1,4-galactosyltransferase 2 OS=Mus musculus OX=10090 GN=B4galt2 PE=2 SV=1
11	Q9GUM2	4.04e-93	286	383	0.341	0.350	BRE4_CAEEL Beta-1,4-N-acetylgalactosaminyltransferase bre-4 OS=Caenorhabditis elegans OX=6239 GN=bre-4 PE=1 SV=1
12	Q3YL68	8.97e-80	252	381	0.338	0.349	B4GT5_DANRE Beta-1,4-galactosyltransferase 5 OS=Danio rerio OX=7955 GN=b4galt5 PE=2 SV=2
13	Q9JMK0	4.97e-79	250	388	0.310	0.314	B4GT5_MOUSE Beta-1,4-galactosyltransferase 5 OS=Mus musculus OX=10090 GN=B4galt5 PE=1 SV=2
14	A0A1S6M251	4.56e-78	248	388	0.308	0.312	B4GT5_PIG Beta-1,4-galactosyltransferase 5 OS=Sus scrofa OX=9823 GN=B4GALT5 PE=1 SV=2
15	O43286	1.71e-77	246	388	0.300	0.304	B4GT5_HUMAN Beta-1,4-galactosyltransferase 5 OS=Homo sapiens OX=9606 GN=B4GALT5 PE=1 SV=1
16	Q802Y5	1.15e-76	244	381	0.313	0.323	Q802Y5_DANRE Beta-1,4-galactosyltransferase OS=Danio rerio OX=7955 GN=zgc:55730 PE=2 SV=1
17	Q9UBX8	1.74e-76	243	382	0.303	0.312	B4GT6_HUMAN Beta-1,4-galactosyltransferase 6 OS=Homo sapiens OX=9606 GN=B4GALT6 PE=1 SV=1
18	O88419	2.65e-76	243	382	0.305	0.314	B4GT6_RAT Beta-1,4-galactosyltransferase 6 OS=Rattus norvegicus OX=10116 GN=B4galt6 PE=1 SV=1
19	Q9WVK5	2.18e-75	240	382	0.305	0.314	B4GT6_MOUSE Beta-1,4-galactosyltransferase 6 OS=Mus musculus OX=10090 GN=B4galt6 PE=1 SV=1
20	Q7KN92	3.19e-71	230	403	0.288	0.280	Q7KN92_DROME Beta1,4-N-acetylgalactosaminyltransferase A OS=Drosophila melanogaster OX=7227 GN=beta4GalNAcTA PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02709 Glyco_transf_7C	2e-26	102.8	N-terminal domain of galactosyltransferase
2	PF13733 Glyco_transf_7N	3.3e-54	193.5	N-terminal region of glycosyl transferase group 7

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000480428

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000343924	0.975	Prolargin
2	9606.ENSP00000353910	0.958	Alpha-(1,6)-fucosyltransferase
3	9606.ENSP00000391227	0.957	Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B
4	9606.ENSP00000386942	0.947	Beta-galactoside alpha-2,6-sialyltransferase 2
5	9606.ENSP00000381699	0.944	Beta-1,3-galactosyltransferase 5
6	9606.ENSP00000319636	0.940	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 4
7	9606.ENSP00000361060	0.940	Protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1
8	9606.ENSP00000169298	0.938	Beta-galactoside alpha-2,6-sialyltransferase 1
9	9606.ENSP00000305595	0.933	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2
10	9606.ENSP00000262915	0.931	ST3 beta-galactoside alpha-2,3-sialyltransferase 3
11	9606.ENSP00000302599	0.931	Alpha-(1,3)-fucosyltransferase 9
12	9606.ENSP00000266383	0.927	Beta-1,4-N-acetylgalactosaminyltransferase 3
13	9606.ENSP00000313398	0.925	Alpha-(1,3)-fucosyltransferase 6
14	9606.ENSP00000480884	0.923	Type 2 lactosamine alpha-2,3-sialyltransferase
15	9606.ENSP00000376456	0.921	Beta-1,3-galactosyltransferase 1
16	9606.ENSP00000384794	0.920	Lactosylceramide 4-alpha-galactosyltransferase
17	9606.ENSP00000436047	0.920	CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4
18	9606.ENSP00000230053	0.919	Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 2
19	9606.ENSP00000312021	0.919	Galactoside 2-alpha-L-fucosyltransferase 1
20	9606.ENSP00000321874	0.917	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008194	1.000	UDP-glycosyltransferase activity
GO:0008378	1.000	galactosyltransferase activity
GO:0035250	0.978	UDP-galactosyltransferase activity
GO:0005515	0.966	protein binding
GO:0140096	0.420	catalytic activity, acting on a protein

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:1901135	0.989	carbohydrate derivative metabolic process
GO:0006643	0.986	membrane lipid metabolic process
GO:0006687	0.977	glycosphingolipid metabolic process
GO:0009247	0.970	glycolipid biosynthetic process
GO:0030148	0.966	sphingolipid biosynthetic process
GO:0006688	0.939	glycosphingolipid biosynthetic process
GO:0046513	0.919	ceramide biosynthetic process
GO:0043170	0.694	macromolecule metabolic process
GO:0019538	0.530	protein metabolic process
GO:0009059	0.512	macromolecule biosynthetic process
GO:0009100	0.423	glycoprotein metabolic process
GO:0034645	0.396	cellular macromolecule biosynthetic process
GO:0009101	0.371	glycoprotein biosynthetic process
GO:0070085	0.342	glycosylation
GO:0009311	0.336	oligosaccharide metabolic process
GO:0036211	0.330	protein modification process
GO:0006486	0.300	protein glycosylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	1.000	Golgi apparatus
GO:0016020	0.996	membrane
GO:0031090	0.990	organelle membrane
GO:0005576	0.975	extracellular region
GO:0000139	0.961	Golgi membrane
GO:0005829	0.892	cytosol
GO:0005615	0.879	extracellular space
GO:0031982	0.847	vesicle
GO:1903561	0.748	extracellular vesicle
GO:0070062	0.719	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.

[back to server]