StarFunc result for job id O60513

User Input

>input (344 residues)
MGFNLTFHLSYKFRLLLLLTLCLTVVGWATSNYFVGAIQEIPKAKEFMANFHKTLILGKG
KTLTNEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQAENPKVSRGRYRPQECKA
LQRVAILVPHRNREKHLMYLLEHLHPFLQRQQLDYGIYVIHQAEGKKFNRAKLLNVGYLE
ALKEENWDCFIFHDVDLVPENDFNLYKCEEHPKHLVVGRNSTGYRLRYSGYFGGVTALSR
EQFFKVNGFSNNYWGWGGEDDDLRLRVELQRMKISRPLPEVGKYTMVFHTRDKGNEVNAE
RMKLLHQVSRVWRTDGLSSCSYKLVSVEHNPLYINITVDFWFGA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B2RAZ5	0.902	0.902	3.445E-71	344	1.000	1.000	B2RAZ5.pdb.gz	B2RAZ5_HUMAN Beta-1,4-galactosyltransferase OS=Homo sapiens OX=9606 GN=B4GALT4 PE=2 SV=1
2	AFDB:O60909	0.779	0.721	5.300E-43	372	0.439	0.406	O60909.pdb.gz	B4GT2_HUMAN Beta-1,4-galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=B4GALT2 PE=1 SV=1
3	AFDB:P08037	0.782	0.671	1.097E-42	402	0.407	0.348	P08037.pdb.gz	B4GT1_BOVIN Beta-1,4-galactosyltransferase 1 OS=Bos taurus OX=9913 GN=B4GALT1 PE=1 SV=3
4	AFDB:A0A384NY44	0.767	0.672	1.579E-42	393	0.453	0.397	A0A384NY44.pdb.gz	A0A384NY44_HUMAN Beta-1,4-galactosyltransferase OS=Homo sapiens OX=9606 PE=2 SV=1
5	AFDB:P15535	0.773	0.668	3.923E-42	399	0.395	0.341	P15535.pdb.gz	B4GT1_MOUSE Beta-1,4-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B4galt1 PE=1 SV=1
6	AFDB:P15291	0.781	0.676	1.242E-41	398	0.401	0.347	P15291.pdb.gz	B4GT1_HUMAN Beta-1,4-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=B4GALT1 PE=1 SV=5
7	AFDB:Q9GUM2	0.775	0.697	2.027E-39	383	0.372	0.334	Q9GUM2.pdb.gz	BRE4_CAEEL Beta-1,4-N-acetylgalactosaminyltransferase bre-4 OS=Caenorhabditis elegans OX=6239 GN=bre-4 PE=1 SV=1
8	AFDB:Q7KN92	0.761	0.652	6.869E-36	403	0.317	0.270	Q7KN92.pdb.gz	Q7KN92_DROME Beta1,4-N-acetylgalactosaminyltransferase A OS=Drosophila melanogaster OX=7227 GN=beta4GalNAcTA PE=2 SV=1
9	AFDB:Q3YL68	0.751	0.679	9.303E-36	381	0.378	0.341	Q3YL68.pdb.gz	B4GT5_DANRE Beta-1,4-galactosyltransferase 5 OS=Danio rerio OX=7955 GN=b4galt5 PE=2 SV=2
10	AFDB:F1QGG1	0.745	0.674	3.137E-34	381	0.355	0.320	F1QGG1.pdb.gz
11	PDB:6pxuB	0.383	0.262	1.131E-6	532	0.122	0.079	6pxuB.pdb.gz	The structure of the colorectal cancer-associated enzyme GalNAc-T12 reveals how nonconserved residues dictate its function.
12	PDB:6iwqA	0.399	0.265	6.980E-6	546	0.145	0.092	6iwqA.pdb.gz	Structural basis of carbohydrate transfer activity of UDP-GalNAc: Polypeptide N-acetylgalactosaminyltransferase 7.
13	PDB:6h0bB	0.427	0.292	2.080E-5	521	0.110	0.073	6h0bB.pdb.gz	Structural and Mechanistic Insights into the Catalytic-Domain-Mediated Short-Range Glycosylation Preferences of GalNAc-T4.
14	PDB:4fixA	0.370	0.211	3.180E-5	629	0.102	0.056	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.
15	PDB:2d7iA	0.419	0.279	7.434E-5	536	0.090	0.058	2d7iA.pdb.gz	Structural basis of carbohydrate transfer activity by human UDP-GalNAc: polypeptide alpha-N-acetylgalactosaminyltransferase (pp-GalNAc-T10)
16	PDB:4d0tA	0.394	0.282	7.899E-5	496	0.096	0.067	4d0tA.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N-Acetylgalactosaminyltransferase 2.
17	PDB:5mlzA	0.309	0.301	7.899E-5	355	0.110	0.107	5mlzA.pdb.gz	Structural basis for dolichylphosphate mannose biosynthesis.
18	PDB:4decA	0.349	0.409	1.208E-4	284	0.105	0.127	4decA.pdb.gz	Mechanistic insights into the retaining glucosyl-3-phosphoglycerate synthase from mycobacteria.
19	PDB:4d11C	0.385	0.312	1.636E-4	436	0.102	0.080	4d11C.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N- Acetylgalactosaminyltransferase 2.
20	PDB:4y63A	0.314	0.373	1.636E-4	282	0.090	0.110	4y63A.pdb.gz	Design of Glycosyltransferase Inhibitors: Serine Analogues as Pyrophosphate Surrogates?

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2RAZ5	0.0	717	344	1.000	1.000	B2RAZ5_HUMAN Beta-1,4-galactosyltransferase OS=Homo sapiens OX=9606 GN=B4GALT4 PE=2 SV=1
2	O60513	0.0	717	344	1.000	1.000	B4GT4_HUMAN Beta-1,4-galactosyltransferase 4 OS=Homo sapiens OX=9606 GN=B4GALT4 PE=1 SV=1
3	A0A384NY44	3.24e-96	292	393	0.439	0.384	A0A384NY44_HUMAN Beta-1,4-galactosyltransferase OS=Homo sapiens OX=9606 PE=2 SV=1
4	O60512	3.24e-96	292	393	0.439	0.384	B4GT3_HUMAN Beta-1,4-galactosyltransferase 3 OS=Homo sapiens OX=9606 GN=B4GALT3 PE=1 SV=2
5	O60909	1.74e-94	287	372	0.398	0.368	B4GT2_HUMAN Beta-1,4-galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=B4GALT2 PE=1 SV=1
6	Q9Z2Y2	2.31e-94	287	369	0.395	0.369	B4GT2_MOUSE Beta-1,4-galactosyltransferase 2 OS=Mus musculus OX=10090 GN=B4galt2 PE=2 SV=1
7	P08037	6.17e-94	287	402	0.398	0.341	B4GT1_BOVIN Beta-1,4-galactosyltransferase 1 OS=Bos taurus OX=9913 GN=B4GALT1 PE=1 SV=3
8	Q99PC2	8.42e-94	286	393	0.392	0.344	Q99PC2_CRIGR Beta-1,4-galactosyltransferase OS=Cricetulus griseus OX=10029 GN=beta4GalT-1 PE=2 SV=1
9	P15291	1.04e-93	286	398	0.398	0.344	B4GT1_HUMAN Beta-1,4-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=B4GALT1 PE=1 SV=5
10	P15535	1.85e-93	286	399	0.395	0.341	B4GT1_MOUSE Beta-1,4-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B4galt1 PE=1 SV=1
11	Q9GUM2	4.19e-80	251	383	0.346	0.311	BRE4_CAEEL Beta-1,4-N-acetylgalactosaminyltransferase bre-4 OS=Caenorhabditis elegans OX=6239 GN=bre-4 PE=1 SV=1
12	Q7KN92	8.96e-70	225	403	0.331	0.283	Q7KN92_DROME Beta1,4-N-acetylgalactosaminyltransferase A OS=Drosophila melanogaster OX=7227 GN=beta4GalNAcTA PE=2 SV=1
13	Q3YL68	1.68e-68	221	381	0.346	0.312	B4GT5_DANRE Beta-1,4-galactosyltransferase 5 OS=Danio rerio OX=7955 GN=b4galt5 PE=2 SV=2
14	O88419	5.82e-65	212	382	0.334	0.301	B4GT6_RAT Beta-1,4-galactosyltransferase 6 OS=Rattus norvegicus OX=10116 GN=B4galt6 PE=1 SV=1
15	Q802Y5	7.17e-65	211	381	0.320	0.289	Q802Y5_DANRE Beta-1,4-galactosyltransferase OS=Danio rerio OX=7955 GN=zgc:55730 PE=2 SV=1
16	A0A1S6M251	2.66e-64	210	388	0.323	0.286	B4GT5_PIG Beta-1,4-galactosyltransferase 5 OS=Sus scrofa OX=9823 GN=B4GALT5 PE=1 SV=2
17	Q9JMK0	3.09e-64	210	388	0.320	0.284	B4GT5_MOUSE Beta-1,4-galactosyltransferase 5 OS=Mus musculus OX=10090 GN=B4galt5 PE=1 SV=2
18	Q9WVK5	1.33e-63	208	382	0.328	0.296	B4GT6_MOUSE Beta-1,4-galactosyltransferase 6 OS=Mus musculus OX=10090 GN=B4galt6 PE=1 SV=1
19	O43286	4.30e-63	207	388	0.317	0.281	B4GT5_HUMAN Beta-1,4-galactosyltransferase 5 OS=Homo sapiens OX=9606 GN=B4GALT5 PE=1 SV=1
20	Q9UBX8	1.22e-62	206	382	0.328	0.296	B4GT6_HUMAN Beta-1,4-galactosyltransferase 6 OS=Homo sapiens OX=9606 GN=B4GALT6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02709 Glyco_transf_7C	1.5e-24	96.8	N-terminal domain of galactosyltransferase
2	PF13733 Glyco_transf_7N	2.6e-55	197.1	N-terminal region of glycosyl transferase group 7
3	PF06298 PsbY	3.7e+02	12.4	Photosystem II protein Y (PsbY)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000420161

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000316173	0.971	Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase
2	9606.ENSP00000376456	0.966	Beta-1,3-galactosyltransferase 1
3	9606.ENSP00000305595	0.962	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2
4	9606.ENSP00000319636	0.962	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 4
5	9606.ENSP00000381699	0.949	Beta-1,3-galactosyltransferase 5
6	9606.ENSP00000368917	0.945	N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase
7	9606.ENSP00000480884	0.945	Type 2 lactosamine alpha-2,3-sialyltransferase
8	9606.ENSP00000436047	0.944	CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4
9	9606.ENSP00000356404	0.939	Beta-1,3-galactosyltransferase 2
10	9606.ENSP00000376532	0.937	UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1
11	9606.ENSP00000343924	0.936	Prolargin
12	9606.ENSP00000321874	0.935	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3
13	9606.ENSP00000466880	0.930	Alpha-(1,3)-fucosyltransferase 5
14	9606.ENSP00000312021	0.926	Galactoside 2-alpha-L-fucosyltransferase 1
15	9606.ENSP00000169298	0.925	Beta-galactoside alpha-2,6-sialyltransferase 1
16	9606.ENSP00000347041	0.925	Fibromodulin
17	9606.ENSP00000384794	0.924	Lactosylceramide 4-alpha-galactosyltransferase
18	9606.ENSP00000266718	0.921	Lumican
19	9606.ENSP00000313398	0.917	Alpha-(1,3)-fucosyltransferase 6
20	9606.ENSP00000266719	0.916	Keratocan

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0035250	1.000	UDP-galactosyltransferase activity
GO:0005488	0.995	binding
GO:0005515	0.994	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.997	primary metabolic process
GO:0006807	0.997	nitrogen compound metabolic process
GO:0044237	0.997	cellular metabolic process
GO:1901135	0.995	carbohydrate derivative metabolic process
GO:0009059	0.991	macromolecule biosynthetic process
GO:0006687	0.991	glycosphingolipid metabolic process
GO:1901137	0.989	carbohydrate derivative biosynthetic process
GO:0044249	0.987	cellular biosynthetic process
GO:1901566	0.985	organonitrogen compound biosynthetic process
GO:0008610	0.980	lipid biosynthetic process
GO:0046467	0.963	membrane lipid biosynthetic process
GO:0009247	0.947	glycolipid biosynthetic process
GO:0030148	0.934	sphingolipid biosynthetic process
GO:0043603	0.881	amide metabolic process
GO:0006022	0.842	aminoglycan metabolic process
GO:0043604	0.842	amide biosynthetic process
GO:0006672	0.833	ceramide metabolic process
GO:0006688	0.825	glycosphingolipid biosynthetic process
GO:0046513	0.785	ceramide biosynthetic process
GO:0030203	0.753	glycosaminoglycan metabolic process
GO:0044260	0.710	cellular macromolecule metabolic process
GO:0019538	0.697	protein metabolic process
GO:0034645	0.628	cellular macromolecule biosynthetic process
GO:0009100	0.627	glycoprotein metabolic process
GO:0006023	0.474	aminoglycan biosynthetic process
GO:0009101	0.437	glycoprotein biosynthetic process
GO:0006486	0.395	protein glycosylation
GO:0006790	0.352	sulfur compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	1.000	Golgi apparatus
GO:0016020	0.996	membrane
GO:0031090	0.988	organelle membrane
GO:0098588	0.978	bounding membrane of organelle
GO:0000139	0.964	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.

[back to server]