StarFunc result for job id O60519

User Input

>input (120 residues)
MDDSKVVGGKVKKPGKRGRKPAKIDLKAKLERSRQSARECRARKKLRYQYLEELVSSRER
AICALREELEMYKQWCMAMDQGKIPSEIKALLTGEEQNKSQQNSSRHTKAGKTDANSNSW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q32M00	0.767	0.750	2.308E-13	123	0.950	0.927	Q32M00.pdb.gz	CRBL2_MOUSE cAMP-responsive element-binding protein-like 2 OS=Mus musculus OX=10090 GN=Crebl2 PE=1 SV=1
2	AFDB:C8V9H0	0.438	0.140	2.549	400	0.200	0.060	C8V9H0.pdb.gz	C8V9H0_EMENI MEAB protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_04900 PE=4 SV=1
3	AFDB:Q5AJU7	0.426	0.114	2.549	499	0.225	0.054	Q5AJU7.pdb.gz	AP1_CANAL AP-1-like transcription factor CAP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAP1 PE=1 SV=2
4	AFDB:P18870	0.409	0.166	2.947	314	0.192	0.073	P18870.pdb.gz	JUN_CHICK Transcription factor Jun OS=Gallus gallus OX=9031 GN=JUN PE=1 SV=2
5	AFDB:P15336	0.417	0.116	3.407	505	0.217	0.051	P15336.pdb.gz	ATF2_HUMAN Cyclic AMP-dependent transcription factor ATF-2 OS=Homo sapiens OX=9606 GN=ATF2 PE=1 SV=4
6	AFDB:Q6FME2	0.415	0.155	3.939	349	0.133	0.046	Q6FME2.pdb.gz	Q6FME2_CANGA Candida glabrata strain CBS138 chromosome K complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=AP5 PE=4 SV=1
7	AFDB:Q38BT4	0.248	0.155	4.896	232	0.142	0.073	Q38BT4.pdb.gz	Q38BT4_TRYB2 Cytochrome C oxidase assembly protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.4380 PE=4 SV=1
8	AFDB:Q38FN2	0.253	0.175	4.896	180	0.133	0.089	Q38FN2.pdb.gz	Q38FN2_TRYB2 Histone acetyltransferase subunit NuA4 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.1570 PE=3 SV=1
9	AFDB:Q9HE01	0.171	0.135	5.265	168	0.108	0.077	Q9HE01.pdb.gz	YKP3_SCHPO Uncharacterized protein C589.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC589.03c PE=4 SV=1
10	AFDB:Q10MI4	0.164	0.037	5.661	895	0.200	0.027	Q10MI4.pdb.gz	EZ1_ORYSJ Histone-lysine N-methyltransferase EZ1 OS=Oryza sativa subsp. japonica OX=39947 GN=EZ1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60519	7.69e-85	244	120	1.000	1.000	CRBL2_HUMAN cAMP-responsive element-binding protein-like 2 OS=Homo sapiens OX=9606 GN=CREBL2 PE=1 SV=1
2	Q0VD32	4.51e-83	240	120	0.983	0.983	CRBL2_BOVIN cAMP-responsive element-binding protein-like 2 OS=Bos taurus OX=9913 GN=CREBL2 PE=1 SV=1
3	Q32M00	4.60e-80	232	123	0.950	0.927	CRBL2_MOUSE cAMP-responsive element-binding protein-like 2 OS=Mus musculus OX=10090 GN=Crebl2 PE=1 SV=1
4	Q9VL14	1.65e-27	99.8	118	0.442	0.449	RTBP_DROME REPTOR-binding partner OS=Drosophila melanogaster OX=7227 GN=REPTOR-BP PE=1 SV=2
5	Q9VWW0	0.31	32.3	359	0.167	0.056	CREBB_DROME Cyclic AMP response element-binding protein B OS=Drosophila melanogaster OX=7227 GN=CrebB PE=1 SV=1
6	Q03061	0.32	32.3	357	0.167	0.056	CREM_RAT cAMP-responsive element modulator OS=Rattus norvegicus OX=10116 GN=Crem PE=1 SV=2
7	P27699	0.35	32.0	357	0.167	0.056	CREM_MOUSE cAMP-responsive element modulator OS=Mus musculus OX=10090 GN=Crem PE=1 SV=2
8	Q03060	0.45	32.0	345	0.167	0.058	CREM_HUMAN cAMP-responsive element modulator OS=Homo sapiens OX=9606 GN=CREM PE=1 SV=6
9	Q9U2I0	0.80	31.2	327	0.167	0.061	CREBH_CAEEL CREB homolog crh-1 OS=Caenorhabditis elegans OX=6239 GN=crh-1 PE=1 SV=2
10	P52890	0.87	31.2	566	0.192	0.041	ATF1_SCHPO Transcription factor atf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atf1 PE=1 SV=1
11	O14975	1.2	30.8	620	0.200	0.039	S27A2_HUMAN Long-chain fatty acid transport protein 2 OS=Homo sapiens OX=9606 GN=SLC27A2 PE=1 SV=2
12	Q39237	1.3	30.4	368	0.175	0.057	TGA1_ARATH Transcription factor TGA1 OS=Arabidopsis thaliana OX=3702 GN=TGA1 PE=1 SV=2
13	Q8LPJ3	1.9	30.0	1024	0.258	0.030	MANA2_ARATH Probable alpha-mannosidase At5g13980 OS=Arabidopsis thaliana OX=3702 GN=At5g13980 PE=2 SV=1
14	Q4H3W1	3.4	29.3	631	0.167	0.032	Q4H3W1_CIOIN Transcription factor protein OS=Ciona intestinalis OX=7719 GN=Ci-ATF2/7 PE=1 SV=1
15	Q55DL8	3.8	29.3	1574	0.133	0.010	Q55DL8_DICDI C2H2-type zinc finger-containing protein OS=Dictyostelium discoideum OX=44689 GN=gxcT PE=4 SV=1
16	H0Y6N5	4.4	28.9	634	0.150	0.028	H0Y6N5_HUMAN Sad1 and UNC84 domain containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=SUN1 PE=1 SV=1
17	P21525	4.4	28.9	755	0.117	0.019	FOSLA_DROME Transcription factor kayak, isoforms A/B/F OS=Drosophila melanogaster OX=7227 GN=kay PE=1 SV=4
18	Q39234	4.6	28.9	384	0.208	0.065	TGA3_ARATH Transcription factor TGA3 OS=Arabidopsis thaliana OX=3702 GN=TGA3 PE=1 SV=1
19	A8MPH9	4.7	28.9	722	0.117	0.019	FOSLD_DROME Transcription factor kayak, isoforms D/sro OS=Drosophila melanogaster OX=7227 GN=kay PE=1 SV=2
20	P39970	4.9	28.9	489	0.150	0.037	ACA1_YEAST ATF/CREB activator 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACA1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00170 bZIP_1	0.44	22.0	bZIP transcription factor
2	PF07716 bZIP_2	3.1e-05	35.2	Basic region leucine zipper

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010369306.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010385004.1	0.863	BLOC-1 related complex subunit 8
2	61622.XP_010384958.1	0.861	KxDL motif containing 1
3	61622.XP_010371632.1	0.857	CREB3 regulatory factor isoform X1
4	61622.XP_010360725.1	0.839	BLOC-1 related complex subunit 6
5	61622.XP_010354393.1	0.829	Biogenesis of lysosomal organelles complex 1 subunit 2
6	61622.XP_010354487.1	0.824	BLOC-1 related complex subunit 7
7	61622.XP_010376152.1	0.801	Biogenesis of lysosomal organelles complex 1 subunit 1
8	61622.XP_010369302.1	0.790	BLOC-1 related complex subunit 5
9	61622.XP_010363060.1	0.776	Component of the BLOC-1 complex, a complex that is required for normal biogenesis of lysosome-related organelles (LRO), such as platelet dense granules and melanosomes. In concert with the AP-3 complex, the BLOC-1 complex is required to target membrane protein cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals. The BLOC-1 complex, in association with SNARE proteins, is also proposed to be involved in neurite extension. Plays a role in intracellular vesicle trafficking and synaptic vesicle recycling
10	61622.XP_010352316.1	0.550	acyl-CoA binding domain containing 4
11	61622.XP_010369298.1	0.550	ETS variant 6
12	61622.XP_010369300.1	0.543	Component of the Wnt-Fzd-LRP5-LRP6 complex that triggers beta-catenin signaling through inducing aggregation of receptor-ligand complexes into ribosome-sized signalsomes.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140110	0.814	transcription regulator activity
GO:0003700	0.787	DNA-binding transcription factor activity
GO:0003677	0.637	DNA binding
GO:0043565	0.485	sequence-specific DNA binding
GO:0003690	0.419	double-stranded DNA binding
GO:0000976	0.393	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0050794	0.988	regulation of cellular process
GO:0009987	0.973	cellular process
GO:0080090	0.923	regulation of primary metabolic process
GO:0051171	0.911	regulation of nitrogen compound metabolic process
GO:0060255	0.908	regulation of macromolecule metabolic process
GO:0031323	0.908	regulation of cellular metabolic process
GO:0048518	0.875	positive regulation of biological process
GO:0019219	0.875	regulation of nucleobase-containing compound metabolic process
GO:0048522	0.871	positive regulation of cellular process
GO:0006355	0.858	regulation of DNA-templated transcription
GO:0009893	0.847	positive regulation of metabolic process
GO:0010604	0.844	positive regulation of macromolecule metabolic process
GO:0051173	0.843	positive regulation of nitrogen compound metabolic process
GO:0045935	0.728	positive regulation of nucleobase-containing compound metabolic process
GO:0050896	0.722	response to stimulus
GO:0051716	0.700	cellular response to stimulus
GO:0009891	0.679	positive regulation of biosynthetic process
GO:0008152	0.676	metabolic process
GO:0045893	0.667	positive regulation of DNA-templated transcription
GO:0071704	0.555	organic substance metabolic process
GO:0044238	0.551	primary metabolic process
GO:0006807	0.512	nitrogen compound metabolic process
GO:0043170	0.407	macromolecule metabolic process
GO:0051246	0.363	regulation of protein metabolic process
GO:0007154	0.362	cell communication
GO:0023052	0.326	signaling
GO:0044237	0.322	cellular metabolic process
GO:0007165	0.313	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.968	nuclear lumen
GO:0005654	0.829	nucleoplasm
GO:0005737	0.391	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]