StarFunc result for job id O60522

User Input

>input (2096 residues)
MCSTPGMPAPGASLALRVSFVDVHPDVIPVQLWGLVGERRGEYLRLSREIQEAAATRGQW
ALGSASASPGELCLVQVGLLWHRCRVVSRQAQESRVFLLDEGRTITAGAGSLAPGRREFF
NLPSEVLGCVLAGLVPAGCGAGSGEPPQHWPADAVDFLSNLQGKEVHGCVLDVLLLHRLV
LLEVPDVFQQMRELGLARRVPDSLFRSLLERYLTAATASVGSGVPVLSRVPLKQKQPGLD
YFYPQLQLGVTEAVVITQVCHPHRIHCQLRSVSQEIHRLSESMAQVYRGSTGTGDENSTS
ATWEEREESPDKPGSPCASCGLDGHWYRALLLETFRPQRCAQVLHVDYGRKELVSCSSLR
YLLPEYFRMPVVTYPCALYGLWDGGRGWSRSQVGDLKTLILGKAVNAKIEFYCSFEHVYY
VSLYGEDGINLNRVFGVQSCCLADRVLQSQATEEEEPETSQSQSPAEEVDEEISLPALRS
IRLKMNAFYDAQVEFVKNPSEFWIRLRKHNVTFSKLMRRMCGFYSSASKLDGVVLKPEPD
DLCCVKWKENGYYRAIVTKLDDKSVDVFLVDRGNSENVDWYDVRMLLPQFRQLPILAVKC
TLADIWPLGKTWSQEAVSFFKKTVLHKELVIHILDKQDHQYVIEILDESRTGEENISKVI
AQAGYAKYQEFETKENILVNAHSPGHVSNHFTTESNKIPFAKTGEGEQKAKRENKTTSVS
KALSDTTVVTNGSTELVVQEKVKRASVYFPLMQNCLEIKPGSSSKGELEVGSTVEVRVSY
VENPGYFWCQLTRNIQGLKTLMSDIQYYCKNTAAPHQRNTLACLAKRTVNRQWSRALISG
IQSVEHVNVTFVDYGDREMVSVKNIYSISEEFLKVKAQAFRCSLYNLIQPVGQNPFVWDV
KAIQAFNEFIDNAWQKNLELKCTIFALASINEELFNIVDLLTPFQSACHFLVEKRLARPV
KLQKPLESSVQLHSYFYSTHDMKIGSEELVYITHIDDPWTFYCQLARNANILEQLSCSIT
QLSKVLLNLKTSPLNPGTLCLAKYTDGNWYRGIVIEKEPKKVFFVDFGNIYVVTSDDLLP
IPSDAYDVLLLPMQAVRCSLSDIPDHIPEEVVVWFQETILDKSLKALVVAKDPDGTLIIE
LYGDNIQISASINKKLGLLSYKDRIRKKESEVLCSTTETLEEKNENMKLPCTEYLSKSVG
YKLPNKEILEESYKPQINSSYKELKLLQSLTKTNLVTQYQDSVGNKNSQVFPLTTEKKEE
ISAETPLKTARVEATLSERKIGDSCDKDLPLKFCEFPQKTIMPGFKTTVYVSHINDLSDF
YVQLIEDEAEISHLSERLNSVKTRPEYYVGPPLQRGDMICAVFPEDNLWYRAVIKEQQPN
DLLSVQFIDYGNVSVVHTNKIGRLDLVNAILPGLCIHCSLQGFEVPDNKNSKKMMHYFSQ
RTSEAAIRCEFVKFQDRWEVILADEHGIIADDMISRYALSEKSQVELSTQVIKSASSKSV
NKSDIDTSVFLNWYNPEKKMIRAYATVIDGPEYFWCQFADTEKLQCLEVEVQTAGEQVAD
RRNCIPCPYIGDPCIVRYREDGHYYRALITNICEDYLVSVRLVDFGNIEDCVDPKALWAI
PSELLSVPMQAFPCCLSGFNISEGLCSQEGNDYFYEIITEDVLEITILEIRRDVCDIPLA
IVDLKSKGKSINEKMEKYSKTGIKSALPYENIDSEIKQTLGSYNLDVGLKKLSNKAVQNK
IYMEQQTDELAEITEKDVNIIGTKPSNFRDPKTDNICEGFENPCKDKIDTEELEGELECH
LVDKAEFDDKYLITGFNTLLPHANETKEILELNSLEVPLSPDDESKEFLELESIELQNSL
VVDEEKGELSPVPPNVPLSQECVTKGAMELFTLQLPLSCEAEKQPELELPTAQLPLDDKM
DPLSLGVSQKAQESMCTEDMRKSSCVESFDDQRRMSLHLHGADCDPKTQNEMNICEEEFV
EYKNRDAISALMPLFSEEESSDGSKHNNGLPDHISAQLQNTYTLKAFTVGSKCVVWSSLR
NTWSKCEILETAEEGTRVLNLSNGMEEIVNPENVWNGIPKLDKSPPEKRGLEVMEI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1R237	0.189	0.188	0.000	2117	0.292	0.290	F1R237.pdb.gz	TDRD6_DANRE Tudor domain-containing 6 OS=Danio rerio OX=7955 GN=tdrd6 PE=1 SV=2
2	AFDB:P61407	0.380	0.374	0.000	2134	0.720	0.708	P61407.pdb.gz	TDRD6_MOUSE Tudor domain-containing protein 6 OS=Mus musculus OX=10090 GN=Tdrd6 PE=1 SV=1
3	AFDB:Q9W198	0.040	0.039	8.010E-5	2175	0.082	0.079	Q9W198.pdb.gz	Q9W198_DROME Over compensating males, isoform A OS=Drosophila melanogaster OX=7227 GN=ocm PE=4 SV=1
4	AFDB:Q9VWP5	0.037	0.033	6.702E-4	2486	0.080	0.068	Q9VWP5.pdb.gz	Q9VWP5_DROME Hat-trick, isoform D OS=Drosophila melanogaster OX=7227 GN=htk PE=1 SV=4
5	AFDB:Q57VP9	0.064	0.057	6.221E-3	2653	0.115	0.091	Q57VP9.pdb.gz	Q57VP9_TRYB2 EF-hand domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29O4.100 PE=4 SV=1
6	AFDB:F1Q6M9	0.036	0.031	7.653E-3	2623	0.082	0.066	F1Q6M9.pdb.gz	F1Q6M9_DANRE Capicua transcriptional repressor b OS=Danio rerio OX=7955 GN=cicb PE=4 SV=2
7	PDB:7okyZ	0.037	0.146	1.047E-2	374	0.017	0.096	7okyZ.pdb.gz	Allosteric transcription stimulation by RNA polymerase II super elongation complex.
8	AFDB:Q86UL8	0.035	0.044	2.157E-2	1455	0.073	0.104	Q86UL8.pdb.gz	MAGI2_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MAGI2 PE=1 SV=3
9	PDB:7ajtUR	0.027	0.074	3.447E-2	482	0.026	0.112	7ajtUR.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
10	AFDB:B2GM63	0.041	0.056	3.622E-2	1018	0.072	0.147	B2GM63.pdb.gz	B2GM63_DANRE Neural friend of GATA-B OS=Danio rerio OX=7955 GN=FOG-B PE=2 SV=1
11	PDB:6tedZ	0.031	0.100	5.218E-2	510	0.014	0.057	6tedZ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
12	AFDB:M9NE05	0.037	0.036	5.482E-2	2192	0.069	0.066	M9NE05.pdb.gz	M9NE05_DROME Neuromusculin, isoform E OS=Drosophila melanogaster OX=7227 GN=nrm PE=4 SV=1
13	AFDB:Q9VC96	0.041	0.040	6.081E-2	2232	0.111	0.104	Q9VC96.pdb.gz	Q9VC96_DROME BRWD3 OS=Drosophila melanogaster OX=7227 GN=BRWD3 PE=1 SV=2
14	PDB:7abi7	0.026	0.209	7.898E-2	236	0.010	0.093	7abi7.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
15	PDB:7un3A	0.033	0.069	9.227E-2	649	0.026	0.083	7un3A.pdb.gz
16	PDB:3mp8A	0.028	0.106	1.078E-1	513	0.009	0.035	3mp8A.pdb.gz	Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation
17	PDB:4pa0B	0.023	0.048	1.078E-1	920	0.005	0.012	4pa0B.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
18	PDB:4pa0A	0.022	0.046	1.259E-1	974	0.003	0.006	4pa0A.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
19	PDB:1k9aB	0.031	0.099	1.397E-1	441	0.013	0.061	1k9aB.pdb.gz
20	PDB:4v6xCA	0.028	0.173	1.471E-1	255	0.005	0.043	4v6xCA.pdb.gz	Structures of the human and Drosophila 80S ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1R237	0.0	925	2117	0.280	0.277	TDRD6_DANRE Tudor domain-containing 6 OS=Danio rerio OX=7955 GN=tdrd6 PE=1 SV=2
2	P61407	0.0	3000	2134	0.721	0.708	TDRD6_MOUSE Tudor domain-containing protein 6 OS=Mus musculus OX=10090 GN=Tdrd6 PE=1 SV=1
3	Q90WE3	3.87e-131	459	1905	0.115	0.126	TDRD6_XENLA Tudor domain-containing 6-like OS=Xenopus laevis OX=8355 GN=tdrd6 PE=1 SV=1
4	A9CPT4	5.67e-36	152	1133	0.092	0.170	TDRD1_ORYLA Tudor domain-containing protein 1 OS=Oryzias latipes OX=8090 GN=tdrd1 PE=2 SV=1
5	Q58EK5	3.63e-34	146	1175	0.099	0.177	TDRD1_DANRE Tudor domain-containing protein 1 OS=Danio rerio OX=7955 GN=tdrd1 PE=1 SV=2
6	Q9BXT4	8.20e-30	132	1180	0.082	0.146	TDRD1_HUMAN Tudor domain-containing protein 1 OS=Homo sapiens OX=9606 GN=TDRD1 PE=1 SV=2
7	Q99MV1	1.38e-21	105	1172	0.063	0.113	TDRD1_MOUSE Tudor domain-containing protein 1 OS=Mus musculus OX=10090 GN=Tdrd1 PE=1 SV=2
8	P25823	2.23e-16	88.6	2515	0.050	0.041	TUD_DROME Maternal protein tudor OS=Drosophila melanogaster OX=7227 GN=tud PE=1 SV=2
9	Q8NHU6	1.56e-11	72.4	1098	0.062	0.117	TDRD7_HUMAN Tudor domain-containing protein 7 OS=Homo sapiens OX=9606 GN=TDRD7 PE=1 SV=2
10	Q9VQ91	7.87e-11	69.7	576	0.024	0.089	TDRKH_DROME Tudor and KH domain-containing protein homolog OS=Drosophila melanogaster OX=7227 GN=papi PE=1 SV=1
11	Q5VCS6	8.30e-11	70.1	1040	0.027	0.055	TDRD5_MOUSE Tudor domain-containing protein 5 OS=Mus musculus OX=10090 GN=Tdrd5 PE=1 SV=3
12	A6NAF9	1.17e-09	66.2	1079	0.040	0.077	TRD7A_DANRE Tudor domain-containing protein 7A OS=Danio rerio OX=7955 GN=tdrd7a PE=2 SV=2
13	Q9Y2W6	1.84e-09	65.1	561	0.019	0.070	TDRKH_HUMAN Tudor and KH domain-containing protein OS=Homo sapiens OX=9606 GN=TDRKH PE=1 SV=2
14	E1C3S7	1.88e-09	65.5	1071	0.042	0.083	TDRD7_CHICK Tudor domain-containing protein 7 OS=Gallus gallus OX=9031 GN=TDRD7 PE=2 SV=1
15	Q8K1H1	1.09e-08	63.2	1086	0.056	0.109	TDRD7_MOUSE Tudor domain-containing protein 7 OS=Mus musculus OX=10090 GN=Tdrd7 PE=1 SV=1
16	Q99MV7	3.87e-08	61.6	1640	0.027	0.035	RNF17_MOUSE RING finger protein 17 OS=Mus musculus OX=10090 GN=Rnf17 PE=1 SV=2
17	Q80VL1	9.27e-08	59.7	560	0.019	0.070	TDRKH_MOUSE Tudor and KH domain-containing protein OS=Mus musculus OX=10090 GN=Tdrkh PE=1 SV=1
18	H9JD76	1.02e-07	59.7	629	0.025	0.084	TDRKH_BOMMO Tudor and KH domain-containing protein homolog OS=Bombyx mori OX=7091 GN=PAPI PE=1 SV=2
19	Q0E910	1.12e-07	59.7	1222	0.025	0.043	Q0E910_DROME Tapas, isoform B OS=Drosophila melanogaster OX=7227 GN=tapas PE=1 SV=1
20	Q9W0S7	3.72e-07	58.2	926	0.018	0.040	SND1_DROME Staphylococcal nuclease domain-containing protein 1 OS=Drosophila melanogaster OX=7227 GN=Tudor-SN PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05641 Agenet	2.3	20.1	Agenet domain
2	PF07039 DUF1325	2.7e+02	13.1	SGF29 tudor-like domain
3	PF15057 DUF4537	0.0026	29.1	Domain of unknown function (DUF4537)
4	PF06003 SMN	2.8e+02	12.2	Survival motor neuron protein (SMN)
5	PF00565 SNase	19	17.1	Staphylococcal nuclease homologue
6	PF00567 TUDOR	1e-156	524.5	Tudor domain
7	PF18104 Tudor_2	12	17.0	Jumonji domain-containing protein 2A Tudor domain
8	PF18336 Tudor_FRX1	18	16.7	Fragile X mental retardation Tudor domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000346065

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000245255	0.996	Piwi-like protein 1
2	9606.ENSP00000359049	0.940	Small RNA 2'-O-methyltransferase
3	9606.ENSP00000349208	0.926	Piwi-like protein 2
4	9606.ENSP00000299001	0.908	Piwi-like protein 4
5	9606.ENSP00000357812	0.891	Tudor and KH domain-containing protein
6	9606.ENSP00000478754	0.830	Probable ATP-dependent RNA helicase DDX6
7	9606.ENSP00000390621	0.796	Putative ATP-dependent RNA helicase TDRD12
8	9606.ENSP00000356846	0.763	Protein maelstrom homolog
9	9606.ENSP00000319169	0.713	Protein arginine N-methyltransferase 5
10	9606.ENSP00000330031	0.701	Piwi-like protein 3
11	9606.ENSP00000235090	0.684	Methylosome protein 50
12	9606.ENSP00000424838	0.672	Probable ATP-dependent RNA helicase DDX4
13	9606.ENSP00000262794	0.666	RNA helicase Mov10l1
14	9606.ENSP00000440190	0.647	Tudor domain-containing protein 3
15	9606.ENSP00000357465	0.635	Tudor domain-containing protein 10
16	9606.ENSP00000240361	0.626	Inactive serine/threonine-protein kinase TEX14
17	9606.ENSP00000315554	0.620	Spermatid maturation protein 1
18	9606.ENSP00000261593	0.611	E3 ubiquitin-protein ligase RNF138
19	9606.ENSP00000283351	0.604	Trafficking protein particle complex subunit 8
20	9606.ENSP00000275016	0.600	24-hydroxycholesterol 7-alpha-hydroxylase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.361	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0032501	0.982	multicellular organismal process
GO:0071704	0.982	organic substance metabolic process
GO:0048856	0.982	anatomical structure development
GO:0044237	0.980	cellular metabolic process
GO:0044238	0.979	primary metabolic process
GO:0007283	0.972	spermatogenesis
GO:0006396	0.970	RNA processing
GO:0007281	0.967	germ cell development
GO:0022607	0.962	cellular component assembly
GO:0071826	0.950	ribonucleoprotein complex subunit organization
GO:0016071	0.931	mRNA metabolic process
GO:0022618	0.919	ribonucleoprotein complex assembly
GO:0000398	0.919	mRNA splicing, via spliceosome
GO:0000387	0.863	spliceosomal snRNP assembly
GO:0065007	0.722	biological regulation
GO:0050789	0.596	regulation of biological process
GO:0019222	0.361	regulation of metabolic process
GO:0060255	0.342	regulation of macromolecule metabolic process
GO:0050794	0.309	regulation of cellular process
GO:0010468	0.306	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0032991	0.999	protein-containing complex
GO:0005829	0.999	cytosol
GO:0033391	0.999	chromatoid body
GO:0043186	0.999	P granule
GO:0012505	0.989	endomembrane system
GO:1990904	0.931	ribonucleoprotein complex
GO:0005783	0.888	endoplasmic reticulum
GO:0030054	0.869	cell junction
GO:0045202	0.793	synapse
GO:0005634	0.776	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]