StarFunc result for job id O60524

User Input

>input (1076 residues)
MKSRFSTIDLRAVLAELNASLLGMRVNNVYDVDNKTYLIRLQKPDFKATLLLESGIRIHT
TEFEWPKNMMPSSFAMKCRKHLKSRRLVSAKQLGVDRIVDFQFGSDEAAYHLIIELYDRG
NIVLTDYEYVILNILRFRTDEADDVKFAVRERYPLDHARAAEPLLTLERLTEIVASAPKG
ELLKRVLNPLLPYGPALIEHCLLENGFSGNVKVDEKLETKDIEKVLVSLQKAEDYMKTTS
NFSGKGYIIQKREIKPSLEADKPVEDILTYEEFHPFLFSQHSQCPYIEFESFDKAVDEFY
SKIEGQKIDLKALQQEKQALKKLDNVRKDHENRLEALQQAQEIDKLKGELIEMNLQIVDR
AIQVVRSALANQIDWTEIGLIVKEAQAQGDPVASAIKELKLQTNHVTMLLRNPYLLSEEE
DDDVDGDVNVEKNETEPPKGKKKKQKNKQLQKPQKNKPLLVDVDLSLSAYANAKKYYDHK
RYAAKKTQKTVEAAEKAFKSAEKKTKQTLKEVQTVTSIQKARKVYWFEKFLWFISSENYL
IIGGRDQQQNEIIVKRYLTPGDIYVHADLHGATSCVIKNPTGEPIPPRTLTEAGTMALCY
SAAWDARVITSAWWVYHHQVSKTAPTGEYLTTGSFMIRGKKNFLPPSYLMMGFSFLFKVD
ESCVWRHQGERKVRVQDEDMETLASCTSELISEEMEQLDGGDTSSDEDKEEHETPVEVEL
MTQVDQEDITLQSGRDELNEELIQEESSEDEGEYEEVRKDQDSVGEMKDEGEETLNYPDT
TIDLSHLQPQRSIQKLASKEESSNSSDSKSQSRRHLSAKERREMKKKKLPSDSGDLEALE
GKDKEKESTVHIETHQNTSKNVAAVQPMKRGQKSKMKKMKEKYKDQDEEDRELIMKLLGS
AGSNKEEKGKKGKKGKTKDEPVKKQPQKPRGGQRVSDNIKKETPFLEVITHELQDFAVDD
PHDDKEEQDLDQQGNEENLFDSLTGQPHPEDVLLFAIPICAPYTTMTNYKYKVKLTPGVQ
KKGKAAKTALNSFMHSKEATAREKDLFRSVKDTDLSRNIPGKVKVSAPNLLNVKRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K9F2	0.291	0.396	0.000	781	0.638	0.880	A0A0G2K9F2.pdb.gz	A0A0G2K9F2_RAT Nuclear export mediator factor OS=Rattus norvegicus OX=10116 GN=Nemf PE=1 SV=2
2	AFDB:O60524	1.000	1.000	0.000	1076	1.000	1.000	O60524.pdb.gz	NEMF_HUMAN Ribosome quality control complex subunit NEMF OS=Homo sapiens OX=9606 GN=NEMF PE=1 SV=4
3	PDB:7aqcR	0.220	0.391	1.778E-21	558	0.103	0.199	7aqcR.pdb.gz	Mimicry of Canonical Translation Elongation Underlies Alanine Tail Synthesis in RQC.
4	PDB:7eofB	0.099	0.524	2.750E-5	181	0.028	0.166	7eofB.pdb.gz	Structure of CCDC25-DNA complex
5	PDB:1k82A	0.129	0.446	4.436E-2	260	0.030	0.123	1k82A.pdb.gz	Structure of formamidopyrimidine-DNA glycosylase covalently complexed to DNA.
6	PDB:4xmmE	0.071	0.081	1.777E-1	896	0.033	0.039	4xmmE.pdb.gz
7	PDB:7v6cB	0.044	0.121	2.393E-1	260	0.032	0.131	7v6cB.pdb.gz	Structure of the Dicer-2-R2D2 heterodimer bound to a small RNA duplex.
8	PDB:2p4bB	0.054	0.148	2.515E-1	260	0.014	0.058	2p4bB.pdb.gz
9	PDB:3m4wA	0.054	0.133	3.558E-1	284	0.020	0.077	3m4wA.pdb.gz	Structural basis for the negative regulation of bacterial stress response by RseB
10	PDB:6d6qH	0.053	0.108	3.739E-1	289	0.025	0.093	6d6qH.pdb.gz	Helicase-Dependent RNA Decay Illuminated by a Cryo-EM Structure of a Human Nuclear RNA Exosome-MTR4 Complex.
11	PDB:6u9fB	0.036	0.198	3.739E-1	133	0.012	0.098	6u9fB.pdb.gz
12	PDB:3ggrB	0.055	0.146	4.338E-1	278	0.023	0.090	3ggrB.pdb.gz
13	AFDB:P32926	0.036	0.038	5.325	999	0.047	0.051	P32926.pdb.gz	DSG3_HUMAN Desmoglein-3 OS=Homo sapiens OX=9606 GN=DSG3 PE=1 SV=2
14	AFDB:Q86UU1	0.026	0.022	6.822	1377	0.047	0.037	Q86UU1.pdb.gz	PHLB1_HUMAN Pleckstrin homology-like domain family B member 1 OS=Homo sapiens OX=9606 GN=PHLDB1 PE=1 SV=1
15	AFDB:Q6ZSB9	0.031	0.039	8.741	765	0.043	0.060	Q6ZSB9.pdb.gz	ZBT49_HUMAN Zinc finger and BTB domain-containing protein 49 OS=Homo sapiens OX=9606 GN=ZBTB49 PE=1 SV=3
16	AFDB:Q63717	0.027	0.055	9.185	448	0.040	0.096	Q63717.pdb.gz	Q63717_RAT Heat shock transcription factor 1 (Fragment) OS=Rattus norvegicus OX=10116 GN=Hsf1 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K9F2	0.0	1360	764	0.633	0.891	A0A0G2K9F2_RAT Nuclear export mediator factor OS=Rattus norvegicus OX=10116 GN=Nemf PE=1 SV=2
2	A0A8I6A2E1	0.0	1834	1065	0.886	0.895	A0A8I6A2E1_RAT Nuclear export mediator factor OS=Rattus norvegicus OX=10116 GN=Nemf PE=1 SV=1
3	A0A8I6A9M7	0.0	1797	1066	0.871	0.879	A0A8I6A9M7_RAT Nuclear export mediator factor OS=Rattus norvegicus OX=10116 GN=Nemf PE=1 SV=1
4	A0A8I6ARH7	0.0	1799	1065	0.871	0.880	A0A8I6ARH7_RAT Nuclear export mediator factor OS=Rattus norvegicus OX=10116 GN=Nemf PE=1 SV=1
5	O60524	0.0	2220	1076	1.000	1.000	NEMF_HUMAN Ribosome quality control complex subunit NEMF OS=Homo sapiens OX=9606 GN=NEMF PE=1 SV=4
6	Q9LTX7	0.0	667	1080	0.397	0.395	Q9LTX7_ARATH Gb
7	Q9VBX1	0.0	820	992	0.463	0.502	NEMF_DROME Ribosome quality control complex subunit NEMF homolog OS=Drosophila melanogaster OX=7227 GN=Clbn PE=1 SV=2
8	Q9USN8	1.19e-139	448	1021	0.264	0.278	RQC2_SCHPO Ribosome quality control complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mtr1 PE=1 SV=2
9	Q12532	3.36e-84	297	1038	0.203	0.210	RQC2_YEAST Ribosome quality control complex subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RQC2 PE=1 SV=1
10	O34693	2.56e-05	50.8	570	0.076	0.144	RQCH_BACSU Rqc2 homolog RqcH OS=Bacillus subtilis (strain 168) OX=224308 GN=rqcH PE=1 SV=2
11	Q09477	7.9	32.7	372	0.027	0.078	DPFF1_CAEEL Zinc finger protein dpff-1 OS=Caenorhabditis elegans OX=6239 GN=dpff-1 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11923 NFACT-C	1.3e-27	107.2	NFACT protein C-terminal domain
2	PF05670 NFACT-R_1	4.1e-31	119.2	NFACT protein RNA binding domain
3	PF18297 NFACT-R_2	8.6e+02	11.5	NFACT protein RNA binding domain
4	PF05833 NFACT_N	8.3e-35	132.1	NFACT N-terminal and middle domains
5	PF17919 RT_RNaseH_2	1.5e+02	13.8	RNase H-like domain found in reverse transcriptase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000298310

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000478783	0.999	E3 ubiquitin-protein ligase listerin
2	9606.ENSP00000263346	0.942	Transcription factor 25
3	9606.ENSP00000363676	0.916	60S ribosomal protein L11
4	9606.ENSP00000321617	0.915	Ankyrin repeat and zinc finger domain-containing protein 1
5	9606.ENSP00000420311	0.892	Ribosomal protein L23
6	9606.ENSP00000375730	0.873	60S ribosomal protein L13a
7	9606.ENSP00000389103	0.869	60S ribosomal protein L23a
8	9606.ENSP00000259469	0.868	60S ribosomal protein L35
9	9606.ENSP00000262584	0.868	60S ribosomal protein L8
10	9606.ENSP00000359345	0.868	60S ribosomal protein L5
11	9606.ENSP00000346001	0.866	60S ribosomal protein L3
12	9606.ENSP00000400467	0.865	L ribosomal proteins
13	9606.ENSP00000354739	0.864	60S ribosomal protein L12
14	9606.ENSP00000351777	0.860	Transitional endoplasmic reticulum ATPase
15	9606.ENSP00000463784	0.859	Component of the large ribosomal subunit.
16	9606.ENSP00000397798	0.855	60S ribosomal protein L17
17	9606.ENSP00000311430	0.852	L ribosomal proteins
18	9606.ENSP00000346015	0.851	Ribosomal protein L27a
19	9606.ENSP00000411409	0.851	E3 ubiquitin-protein ligase ZNF598
20	9606.ENSP00000298283	0.846	60S ribosomal protein L10-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.448	organic cyclic compound binding
GO:1901363	0.446	heterocyclic compound binding
GO:0003676	0.428	nucleic acid binding
GO:0003723	0.404	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.994	primary metabolic process
GO:0006807	0.993	nitrogen compound metabolic process
GO:0044237	0.993	cellular metabolic process
GO:0043170	0.992	macromolecule metabolic process
GO:0019941	0.981	modification-dependent protein catabolic process
GO:0010498	0.955	proteasomal protein catabolic process
GO:0051179	0.852	localization
GO:0046907	0.839	intracellular transport
GO:0071840	0.837	cellular component organization or biogenesis
GO:0034641	0.748	cellular nitrogen compound metabolic process
GO:0010467	0.738	gene expression
GO:0006511	0.673	ubiquitin-dependent protein catabolic process
GO:0051169	0.621	nuclear transport
GO:0016043	0.597	cellular component organization
GO:0043161	0.564	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0043603	0.528	amide metabolic process
GO:0043933	0.514	protein-containing complex organization
GO:0009059	0.507	macromolecule biosynthetic process
GO:0044271	0.507	cellular nitrogen compound biosynthetic process
GO:0006412	0.499	translation
GO:0044085	0.439	cellular component biogenesis
GO:0065007	0.412	biological regulation
GO:0050789	0.386	regulation of biological process
GO:0006913	0.356	nucleocytoplasmic transport
GO:0050794	0.352	regulation of cellular process
GO:0051168	0.352	nuclear export
GO:0065003	0.351	protein-containing complex assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005829	1.000	cytosol
GO:0043231	0.954	intracellular membrane-bounded organelle
GO:0016020	0.935	membrane
GO:1990112	0.690	RQC complex
GO:0005634	0.543	nucleus
GO:0070013	0.538	intracellular organelle lumen
GO:0043232	0.412	intracellular non-membrane-bounded organelle
GO:0071944	0.301	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]